KEGG   Ureaplasma urealyticum: UUR10_0231Help
Entry
UUR10_0231        CDS       T00781                                 

Definition
(GenBank) ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
uue  Ureaplasma urealyticum
Pathway
uue03010  Ribosome
Brite
KEGG Orthology (KO) [BR:uue00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    UUR10_0231
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:uue03011]
    UUR10_0231
Ribosome [BR:uue03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    UUR10_0231
  Bacteria
    UUR10_0231
  Archaea
    UUR10_0231
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 DUF365
Motif
Other DBs
NCBI-ProteinID: ACI59859
UniProt: B5ZB45
Position
266454..267389
Genome map
AA seq 311 aa AA seqDB search
MTNKVIQRNIHISHRKASLVIDLVRNKPVHEAIRILSNTPKKFAPIVLKLLNSAISNVQH
NSKDMDPSKLYIYKIVANQGPTMKRTLPRAKGSADQLFKRTTHLEIVLSDDVNEREKELA
AIKAKKSKKPLVVEPVAKVETKKVAKPSKVETKPVEKDENVDPELLKREQQVLKVVEKTA
SQKEEETTETIMISTSPKNAQVLFDDLEKNVIFYKTTPVNKVLRVLVYVTSPTKKVVGEF
DLESVEIGAISSIWRKYNKQSVISKKEYDAYYEGKDKAHALVSKKAYKYRNPKDLSEYNM
TKGPSGFQYLK
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgacaaataaagttattcaaagaaatattcatatttcgcaccgtaaagcttctcttgta
attgatttagttcgaaacaagccagtacatgaagcaattcgaattttaagcaatacacca
aagaagtttgctccaatcgttttgaaattacttaactcagcaatttcaaacgttcaacat
aactctaaagatatggatccaagtaaactatatatttacaaaattgtagctaatcaaggt
ccaacaatgaaaagaacactaccacgtgctaagggttctgctgatcaattatttaaacgt
acaacacatttagaaattgttttatctgatgatgttaatgaacgtgaaaaagaattagca
gctattaaagctaaaaaatcaaaaaaaccattagtagttgaaccagtcgctaaagttgaa
actaaaaaagttgctaaaccaagcaaagtagaaacaaaaccagttgaaaaagacgaaaac
gttgatccagaacttttaaaacgtgaacaacaagttttaaaagttgttgaaaaaactgct
tcacaaaaagaagaagaaacaactgaaacaattatgatttcaacatcacctaagaatgca
caagttttatttgatgatttagaaaaaaatgtaatcttttataaaacaacacctgttaat
aaagttttacgtgtactagtttatgtaactagcccaactaaaaaagttgttggtgaattt
gatttagaatcagttgaaattggtgcaatctcatcaatttgaagaaaatacaacaaacaa
tctgtaatttctaaaaaagaatatgatgcttactatgaaggaaaagataaagcacatgca
cttgtaagcaaaaaagcatataaataccgtaatccaaaagatcttagcgaatacaacatg
actaaaggtccaagtggattccaatatttaaaatag

DBGET integrated database retrieval system