KEGG   Ureaplasma parvum serovar 3 ATCC 700970: UU197Help
Entry
UU197             CDS       T00040                                 

Gene name
metS
Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
uur  Ureaplasma parvum serovar 3 ATCC 700970
Pathway
uur00450  Selenocompound metabolism
uur00970  Aminoacyl-tRNA biosynthesis
uur01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:uur00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    UU197 (metS)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    UU197 (metS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:uur01007]
    UU197 (metS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:uur03016]
    UU197 (metS)
Enzymes [BR:uur01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     UU197 (metS)
Amino acid related enzymes [BR:uur01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   UU197 (metS)
Transfer RNA biogenesis [BR:uur03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    UU197 (metS)
 Prokaryotic type
   Other AARSs
    UU197 (metS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1 tRNA-synt_1f DUF3819
Motif
Other DBs
NCBI-ProteinID: AAF30604
UniProt: Q9PQU6
Position
239809..241374
Genome map
AA seq 521 aa AA seqDB search
MLKQKKFFISTPIYYSSGNPHIGHAYTTIIADVLARYKRLFGYDVFFLTGMDEHGQKIQQ
KAFEENISPKALVDRNSIIFLNLWKRLNISFSKFIRTTQMDHEESVQKVFSYLYKQGKIY
LGQWTGYYCVSCEENYNPAEIIKSQDNIMLCRMGHKLETKSEESYFYKMSDQAPFLKTYY
QNHPNFIIPNERANEMVNNFLNNLEDLSISRTTFDWGIPIAENPKHVIYVWLDALMNYLT
ATGYLSNNEELFQKYWCDNETEIVHLLSKEIARFHCIYWPIFLNDLQIRFPSTILSHGWI
ITKEGKMSKSLGNVIDPNVLIDTYGVDALRYYLMADLSLFRDAIFSEDNLIETYNTQLAN
SYGNMISRTLGMLKKYRNNIVPKYVGCVLKNDEKLENLINKNIELVQENINKYSIDKALN
CIQEILVEANKYIEDNKPWELAKNQQEQELDSLLVHLVKVIQVTTTLLSPILIEGSKKAV
EQLNFDESFLTLASLASYDIFNYHKVNDSKPIFARIIVEKQ
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaacaaaagaaattttttatctctactcccatttactattcttctggaaatcct
catattggtcatgcttatacaacgatcattgctgatgttttagcacgttataaacgcttg
tttggatatgatgttttctttttaacaggaatggatgagcatggtcaaaaaatccaacaa
aaagcttttgaagaaaacatttctcccaaagctttggtcgatcgtaattcaattattttt
ttaaatttatgaaaacgattaaatattagtttttcaaaatttattcgtacaacgcaaatg
gatcatgaagagtctgtacaaaaagtttttagttatttatataaacaaggaaaaatttat
ttaggccaatggacaggttattattgtgtatcatgcgaagaaaattataatcctgctgaa
attattaaaagtcaagataatataatgttatgtcgcatgggtcataaattagaaactaag
tctgaagaatcatatttttataaaatgagtgatcaagcaccatttttaaaaacttactat
caaaatcatccgaatttcattattccaaatgaacgtgcaaatgaaatggttaataacttc
ttaaataatttagaagatttaagtatttcacgtactacttttgattgagggattcctatt
gctgaaaatccaaaacatgtaatttatgtttgattagatgcattaatgaattatttaact
gcaactggttatttatcaaataatgaggaattatttcaaaaatattgatgtgataatgaa
actgaaattgttcatttattatcaaaggaaattgcgcgttttcactgcatttattgacca
atctttttaaatgatttacaaattcgttttccatcaacaattttatcacatggatgaatc
attacaaaagaaggcaaaatgtctaaatcattaggcaatgtaattgatcctaatgtttta
attgatacttatggtgtggatgcacttcgttattatttaatggctgatttaagtttattt
agagatgctatttttagtgaagataatttgattgaaacttataatactcaattagcaaat
agttatggtaacatgatttcaagaacattgggaatgttaaaaaaatatcgaaataatata
gttccaaaatatgttggttgtgttttaaaaaatgatgaaaaattagaaaatttaattaat
aaaaatattgaattagttcaagaaaacattaataaatatagtattgataaagcacttaat
tgcattcaagaaattttagttgaagcaaataaatatattgaagataataaaccttgagaa
ttagctaaaaatcaacaagagcaagaattagattcacttttagttcatttagtaaaagtt
attcaagtaactactactttattatcaccaattttaattgaaggaagtaaaaaagcagtt
gaacaattaaattttgatgaatcttttttaactttagctagtttagcatcttatgatata
ttcaactaccataaagttaatgattcaaaaccaatttttgcaagaatcattgtagaaaaa
caataa

DBGET integrated database retrieval system