KEGG   Ureaplasma parvum serovar 3 ATCC 700970: UU510
Entry
UU510             CDS       T00040                                 

Symbol
ABC-2
Name
(GenBank) ABC Transporter
Organism
uur  Ureaplasma parvum serovar 3 ATCC 700970
SSDB
Motif
Pfam: Peptidase_C39 ABC_tran ABC_membrane AAA_29 AAA_22 AAA_16 Peptidase_C70 AAA_7 AAA_24 UL97 SMC_N RsgA_GTPase Roc TniB Phytochelatin AAA NACHT AAA_5
Other DBs
NCBI-ProteinID: AAF30922
UniProt: Q9PPY0
Position
630813..632789
AA seq 658 aa
MKIVQQTSDNECGVCVINMLANYYHNKTIDKNIILQKANLTKNGLSLQELENLANEFNLD
AQSFECSFEELIDEKINDYFIALINKNGLNHFVIVKNYNKNFFRIYDPENKIYELNNEEF
KKIFLNIIVRVSKNHQIFDLPIFKESYLKNIKLSSLIIILFIELLNIPLNIFLSKIVNLL
IDLVLIDTQIKNLTYLFIVFSLFYISNAFKDLLITIYINKISNNIFSNINNKIVNNLANK
SIIFFNKTNLGELSSIQIHLNNIIHFLLVSRIKLLVNTLFAICIICLLGLQNWSLLLISL
GFSLLNFIIGLINWKYFKIHSLKIINIENSLFIKYQNFIKLINLEYNIDKYNNYINSYKK
QFDELIIFKNKITIFKSNVNFYLSIINNIGLLILLTYLIINTNYDYKVISVITYIVFLHQ
NLNNLFFGIFNFFNELLNFKNGKQIVEKILYIDNYEEHDGIQINKITSCKITENQKEFEF
SKSCLIIGKSGVGKTTLLKNFLNFNNKNLFFNNLNVNNINLNQLKELIIYHPTNPLINDF
DINWFIDKNEEIINALKIVIFITKIDWSLNNNFEHNINLSTGQQQILAFLNLLKYKNKLL
LLDEPLAHVDNDNKKIILNSILPIILKNNFVIYVSHDHYLKKYFDQIINLNDEKMDKY
NT seq 1977 nt   +upstreamnt  +downstreamnt
atgaaaattgttcaacaaacttctgataatgaatgtggtgtgtgtgttattaacatgtta
gcaaattattatcataataaaacaattgataaaaacatcattcttcaaaaagcaaattta
acaaaaaatggtttgagtttgcaagaacttgaaaacttagcaaatgaatttaatttagat
gcacaatcatttgaatgtagttttgaggagttaattgatgaaaaaatcaatgactatttt
atagctttaattaacaaaaacggtttgaatcattttgttattgttaaaaattataacaaa
aatttttttcgtatttatgatccagaaaataaaatatatgaattaaataatgaagaattt
aaaaaaatatttttaaatataattgtgcgtgtttctaaaaatcatcaaatttttgacctt
cccatatttaaagaatcttatttaaaaaatattaaactctcatcgttaattatcatatta
tttatagagttattaaatattcctttaaatatttttttaagtaaaattgtaaacttacta
atagatttagttttaattgacacacaaattaaaaacttaacatacttatttattgttttt
agtttattttatattagtaatgctttcaaagatttactaattactatatacataaataaa
attagtaataatattttttctaatattaataataaaatagttaataatttagctaataaa
tcaattattttttttaataaaacaaatttaggtgaattaagctcgattcagattcatttg
aataatataattcattttctattagttagtcgtataaaattattagttaatactttattt
gcaatttgtattatttgtttattaggtttacaaaattgatctttattattaataagttta
gggtttagtttgttaaattttataataggattgattaattgaaaatattttaaaatccac
agtttaaaaataattaatattgaaaactcattatttattaaatatcaaaattttattaaa
ttaattaatctcgaatacaatatcgataaatataataactatattaatagttataaaaag
caatttgatgaattaataatttttaaaaataaaattactatttttaaatcgaatgtaaat
ttttatttatcaattattaataatattggtttattgattttattaacttatctaatcatt
aataccaattatgattataaagttattagcgtaatcacttatatagtttttttacatcaa
aatctaaataatttgttttttggtatctttaatttttttaatgaattattaaattttaaa
aatggaaaacaaattgttgaaaaaattttgtatattgataattatgaagaacatgatggt
atacaaattaataaaattacatcatgtaaaattaccgaaaaccaaaaggaatttgaattt
agcaaatcttgtttaatcataggaaaaagtggtgttggaaaaacaacattattaaaaaat
tttttaaactttaataataaaaatttattttttaataacttaaatgtaaataatataaat
ttaaatcaacttaaagaattaattatctatcatccaacaaatcctttaataaatgatttt
gatataaattggtttatagataaaaatgaagaaattattaatgctttaaaaatagttatt
tttataacaaagatcgattgatcattaaataataattttgaacataatattaacttatca
actggtcaacaacaaatccttgcttttttaaatcttttaaaatacaaaaataaattatta
ctacttgatgaaccactagcacatgttgataatgataataaaaaaataattttaaactca
atattgcctataattctaaaaaataattttgtcatttatgtttcacatgatcattattta
aaaaaatattttgatcaaataattaatttaaatgatgaaaaaatggataagtattag

DBGET integrated database retrieval system