KEGG   Ureaplasma parvum serovar 3 ATCC 700970: UU594Help
Entry
UU594             CDS       T00040                                 

Gene name
tdk
Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
uur  Ureaplasma parvum serovar 3 ATCC 700970
Pathway
uur00240  Pyrimidine metabolism
uur01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:uur00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    UU594 (tdk)
Enzymes [BR:uur01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     UU594 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_14 ATPase_2 Gp45_2
Motif
Other DBs
NCBI-ProteinID: AAF31008
UniProt: Q9PPP5
Structure
PDB: 

Position
complement(742334..743005)
Genome map
AA seq 223 aa AA seqDB search
MAKVNAFSKKIGWIELITGPMFAGKTAELIRRLHRLEYADVKYLVFKPKIDTRSIRNIQS
RTGTSLPSVEVESAPEILNYIMSNSFNDETKVIGIDEVQFFDDRICEVANILAENGFVVI
ISGLDKNFKGEPFGPIAKLFTYADKITKLTAICNECGAEATHSLRKIDGKHADYNDDIVK
IGCQEFYSAVCRHHHKVPNRPYLNSNSEEFIKFFKNKKRNKNI
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atggctaaagtgaatgcattttcaaaaaaaataggatgaatagaattaattactggccca
atgtttgctggaaaaacagcagagttaattcgtcgcttacatcgtttagaatatgcagat
gttaaatatttggtttttaaacctaaaattgatactagatctattagaaatatccaatca
cgaacaggaacgtctttaccatcagttgaagtagaaagcgcaccagaaattttaaattat
attatgtcaaacagttttaatgatgaaacaaaagttattggcattgatgaggttcaattt
tttgatgatcggatttgtgaagttgcaaatattttagcagaaaatggttttgttgttatt
atttcaggattagataaaaattttaaaggcgagccttttggtccaattgctaaacttttt
acttatgctgataaaattacaaaactaacagcgatatgtaatgagtgtggcgctgaagca
acgcattcattgcgtaagattgatggtaaacacgctgactataatgatgatattgttaaa
attggctgtcaggaattctattctgctgtttgtcgtcatcatcataaggtacctaatcgt
ccttatttaaatagtaattctgaggaatttattaaattttttaaaaataaaaaacgaaat
aaaaatatataa

DBGET integrated database retrieval system