KEGG   Variovorax sp. PAMC 28711: AX767_08445Help
Entry
AX767_08445       CDS       T04325                                 

Definition
(GenBank) integrase
  KO
K13821  RHH-type transcriptional regulator, proline utilization regulon repressor / proline dehydrogenase / delta 1-pyrroline-5-carboxylate dehydrogenase [EC:1.5.5.2 1.2.1.88]
Organism
vaa  Variovorax sp. PAMC 28711
Pathway
vaa00250  Alanine, aspartate and glutamate metabolism
vaa00330  Arginine and proline metabolism
vaa01100  Metabolic pathways
vaa01110  Biosynthesis of secondary metabolites
vaa01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:vaa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AX767_08445
   00330 Arginine and proline metabolism
    AX767_08445
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:vaa03000]
    AX767_08445
Enzymes [BR:vaa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     AX767_08445
  1.5  Acting on the CH-NH group of donors
   1.5.5  With a quinone or similar compound as acceptor
    1.5.5.2  proline dehydrogenase
     AX767_08445
Transcription factors [BR:vaa03000]
 Prokaryotic Type
  Ribbon-helix-helix
   Other families
    AX767_08445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh Pro_dh Pro_dh-DNA_bdg
Motif
Other DBs
NCBI-ProteinID: AMM24377
UniProt: A0A126ZBJ0
Position
complement(1692248..1695229)
Genome map
AA seq 993 aa AA seqDB search
MRLPTPYRPEADVVAHRLAALADALDWAAAAAAAAAPWVQQVRKHPPPFWAMESLLREYP
ISSAEGLALMRLAEALLRVPDAETAIALTADQLGRADFDGAADSALSRLSSSAIAMSKKF
LPHNEGQGDHPPGLMAKLGARTVVAATLRAVQLLGRQFVLGQTIDEAMGEARSAHRKHAA
LRFSYDMLGEGARTDADAMRYLESYVHAINAIATGADRTGAPEQNDGISIKLSALHPRYE
DAQHARVMRELVPRVWPLCQLAAASNLNLTIDAEEVDRLELSLDVFEALAAKVAAELPQW
RGFGLALQSYQTRALELIDHVIAIARKHKLRLMCRLVKGAYWDAEIKRAQELGLPHYPVF
THKHHSDVSYLACARALLAAPDAIYPQFATHNAGTIAAILQMAKRANAPFELQRLHGMGE
GIYREVMKTTTAPVRIYAPVGQHKDLLAYLVRRLLENGANSSFVNQLGDESIGMDELLVS
PLWFDAAESFPLPPRLYGPSPARPNSTGLDLTVEPMRAPLFAAFASTRVPTVPEADAASA
DRAVAASAACFRTWRKTPVAARAAMLRDAADALQADLPRFCALLVKEAFKTWGDAIAEVR
EAVDFLRYYADEAERIMQPVALPGPTGESNELRLTARGPWVCISPWNFPLAIFMGQVAAA
LATGNTVLAKPAEQTPAVALEAVKLLQAAGVPADALQLLHGPGETVGAALVAASGVAGVV
FTGSTQVAKIIHRALAAKDGAIVPLIAETGGINAMLVDSSALPEQVVDAVVQSAFRSAGQ
RCSALRLLVLHERIADHVIEMIHGAAGALVAGDASELSTDVGPVIDREAADTIHRHLERL
DSTAKVLVAPAGPASAATTLIAPHAYEVTSIDDVKAEIFGPVLQIARWSGDPADAIDRIN
ALGYGLTLGIQTRIDSRAQALASRAHVGNVYVNRNIIGAVVGVQPFGGEGLSGTGPKAGG
PHYLYRFCAEQTVTVNTTAAGGNAALLAGLGAH
NT seq 2982 nt NT seq  +upstreamnt  +downstreamnt
atgcgcctgcccacgccctatcgccccgaagccgacgtcgtcgcgcaccgcctcgccgca
ttggccgacgctctcgactgggccgccgccgccgccgcggccgccgcgccctgggtgcag
caggtccgcaagcacccgccgccgttctgggcgatggaaagcctgttgcgcgagtacccg
atctccagcgccgaaggcctcgcgctcatgcgcctggcggaagcgctgctgcgggtgccc
gatgccgagaccgccatcgcgctcaccgccgaccagctcgggcgcgctgatttcgacggc
gcggcggattcggcgctctcgcgcctgtcgtcgtcggcgatcgcgatgtccaaaaaattc
ctgccgcacaacgaaggacaaggcgaccacccgccgggcctgatggccaagctcggcgcc
cgcacggtcgttgccgccaccttgcgcgcggtgcagctgctcggccgccagttcgtgctc
ggccagaccatcgacgaggcgatgggcgaggcgcggtcggcgcaccgcaagcacgcggcg
ctgcggttcagctacgacatgctcggcgaaggcgcgcgcaccgacgcggatgcgatgcgc
tacctggagagctacgttcatgcgatcaatgcgatcgcgacgggtgccgaccggacgggt
gcgccagagcagaacgacggcatctccatcaagctgagcgcgctgcacccgcgttatgaa
gacgctcagcacgcgcgcgtgatgcgcgaactggtgccgcgcgtctggccgctgtgccag
ctcgcggcggcatcgaacctcaacctcacgatcgacgccgaggaagtcgaccggctcgaa
ctgtcgctcgatgtcttcgaggcgctggccgcgaaggtggcggccgaactgccgcagtgg
cgcggcttcggcctcgcgctgcagtcgtaccagacgcgcgcgctggaactcatcgaccac
gtcatcgccatcgcccgcaaacacaagctgcgcctcatgtgccggctggtgaagggcgcc
tactgggacgccgagatcaagcgcgcccaggagctcggcctgccgcactaccctgtcttc
acccacaagcaccacagcgacgtgagttaccttgcctgcgcgcgggcgctgctggccgcg
cccgacgccatctacccgcagttcgccacgcacaacgctggcaccatcgcggccatcttg
cagatggcaaagcgtgcgaatgccccgttcgagctgcagcggttgcacggcatgggcgag
ggcatctaccgcgaggtgatgaaaacgacgaccgcgccggtgcgcatctacgcgccggtc
ggccagcacaaggatcttctggcctacctggtgcgccgcctgctggagaacggcgccaat
tcgtctttcgtgaaccagctcggcgacgagtcgatcggcatggacgaattgctggtgtcg
ccgctctggttcgacgccgccgaatcgttcccgctgccgccccgtttgtatggtccgtca
cccgcgcggccgaacagcacgggactggacctcacggtcgagccgatgcgcgcaccgttg
ttcgccgccttcgcgtcgacccgcgtgcccactgtgccggaggccgatgccgcgtcggcc
gaccgtgccgtcgccgcgagcgccgcgtgcttccgcacctggcgcaagacgccggtcgcg
gcgcgcgcggcgatgttgcgcgacgcggccgatgcgctccaggcggacttgccgcgcttt
tgcgcgttgctcgtgaaagaagctttcaagacctggggcgacgccatcgccgaggtgcgc
gaggcggtcgatttcctgcgctactacgccgacgaggccgagcggatcatgcagcccgtc
gcgctgcccggtcccacgggagaaagcaacgaactgcgcctgaccgcacgcggcccgtgg
gtctgcatcagcccgtggaatttcccgctggcgatcttcatgggccaggtggccgccgca
ctcgccaccggcaacacggtgctcgccaaaccggccgaacagacgcccgccgtcgcgctc
gaagccgtgaagctgctgcaggccgccggtgtgccggccgacgccttgcaactgctgcat
ggccccggcgagaccgtcggtgcggcgctggtcgcagcgtccggcgtggcgggcgtcgtg
ttcaccggctcgacgcaggtcgcgaagatcatccaccgagcgctcgccgcgaaagacggc
gcgatcgtcccgctgatcgccgagaccggcggcatcaacgcgatgctggtcgattcgagc
gcgctgcccgagcaggtggtcgacgcagtggtgcagagcgcgttccgctcggctggccag
cgctgctccgcgctgcgcctcctggtgctgcacgagcggatcgccgaccacgtgatcgag
atgattcatggcgcagccggtgcgctcgtcgccggcgatgcgagtgaactttccaccgac
gtcggtcccgtgatcgaccgcgaggcggccgacacgatccaccgccacctcgagcgcctc
gattcgacggccaaggtgctcgtggcgcccgccggcccggcgtcggcggcgacgaccctg
atcgcgccgcacgcctacgaagtgacatcgatcgacgatgtgaaagcggagatctttggg
ccggtgttgcagatcgcacgctggtcgggcgatccggccgacgcgatcgaccgcatcaac
gcgctgggctacggcctcacgctgggcattcagacgcgcatcgattcgcgcgcgcaggcg
ctggcgtcgcgggcgcacgtcggcaacgtctacgtcaaccgcaacatcatcggcgcggtg
gtcggcgtgcagcctttcggtggtgaaggcctgagcggcaccgggccgaaagccggcggg
ccgcactacctctaccgcttttgcgcggagcagacggtcacggtgaacaccacggccgcg
ggcggcaacgcggccttgttggcagggctgggcgcccattga

DBGET integrated database retrieval system