KEGG   Variovorax sp. PAMC 28711: AX767_09450Help
Entry
AX767_09450       CDS       T04325                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
vaa  Variovorax sp. PAMC 28711
Pathway
vaa00480  Glutathione metabolism
vaa00590  Arachidonic acid metabolism
vaa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vaa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    AX767_09450
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AX767_09450
Enzymes [BR:vaa01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     AX767_09450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: AMM24548
UniProt: A0A126ZBP2
Position
1885484..1885969
Genome map
AA seq 161 aa AA seqDB search
MTTVFDFEAQQIDGKTVKLSDYRGKVLLIVNTASKCGFTPQFEGLETLYEKYAEQGLVVL
GFPSNQFASQDPGSNEEIGAFCLKNYGVSFPMMEKIEVNGSGATPLYQWLTKEKPGLLGS
TAIKWNFTKFLVARDGSVLKRYAPLDTPASMTRDVEAALAG
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgaccacggttttcgatttcgaagcccagcagatcgacggcaagaccgtgaagctgtcc
gactaccgcggcaaggtgctgctgatcgtgaacaccgccagcaagtgcgggttcacgccg
cagttcgaggggctggagacgctctacgaaaagtatgcggaacagggcttggtggtcttg
ggctttccatcaaatcagttcgcgtcgcaagacccgggcagcaatgaagagatcggcgcg
ttctgtctcaagaactacggcgtgagttttccgatgatggaaaagatcgaggtgaacggc
agcggcgcgacgccgctctaccagtggctcaccaaagaaaagcccggcctcctgggcagc
acggccatcaagtggaacttcaccaagttcctggtcgcgcgcgacgggtccgtgctcaag
cgctatgcgccgctcgacacgcctgcttcgatgacgcgcgacgtcgaggccgcgctggct
ggctga

DBGET integrated database retrieval system