KEGG   Variovorax sp. PAMC 28711: AX767_15490Help
Entry
AX767_15490       CDS       T04325                                 

Definition
(GenBank) inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
vaa  Variovorax sp. PAMC 28711
Brite
KEGG Orthology (KO) [BR:vaa00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    AX767_15490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 FGGY_C Myc_target_1 FeoB_C
Motif
Other DBs
NCBI-ProteinID: AMM25604
UniProt: A0A126ZG92
Position
3203410..3204420
Genome map
AA seq 336 aa AA seqDB search
MATVQVALWVVVVLVVLAILFDFMNGFHDAANSIATVVSTGVLKPGQAVVFAAFFNLIAI
FVFHLSVAATVGKGIAQPGIVDVHVVFGALIGAISWNFVTWYYGIPSSSSHALIGGIVGA
VIAKAGAGALVASGIWKTVAFIFVSPLLGFLLGSFMMILVAWVFRRSTPSRVDRWFRRLQ
LVSAGAYSLGHGGNDAQKTIGIIWMLLIATGYASAADAAPPLWTIVSCYTAIAMGTMFGG
WRIVKTMGQKITKLKPVGGFCAETGGALTLFLATALGIPVSTTHTITGAIVGVGSVQRAS
AVRWGVAGTIVWAWIFTIPASAFVAAVAYWISLQIF
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atggcaacggttcaggtcgccctgtgggtggtggtcgtgctggtggtgctggcgatcctg
ttcgacttcatgaacggattccacgatgcggcgaactcgatcgcgacggtggtctcgacc
ggcgtgctcaaacccggccaggcggtggtgttcgccgccttcttcaatctcatcgcgatc
ttcgtgttccacctgagcgtggcggccaccgtgggcaaaggcatcgcccagccgggcatc
gtcgatgtgcacgtggtgttcggcgctctcatcggcgcgatcagctggaacttcgtcacc
tggtattacggcattcccagcagctcgtcgcacgcgctgatcggcggcattgtcggcgca
gtgatcgccaaggccggcgccggtgcgctggtggcatcgggcatctggaagacggtcgcg
ttcatcttcgtgtcgccgctgctgggttttctgctcggttcgttcatgatgatcctggtg
gcctgggtgttccggcgctcgacgccgtcccgcgtcgaccgctggtttcgccggctgcag
ctggtgtctgcaggcgcctacagcctcgggcatggcggcaacgatgcgcagaagaccatc
ggcatcatctggatgctgctgatcgcgaccggctatgcgtcggccgccgacgcggcgccg
ccgctctggaccatcgtgagctgctacaccgcgatcgcgatgggcaccatgttcgggggc
tggcgcatcgtgaagacgatggggcagaagatcaccaagctcaagcctgtcgggggtttc
tgcgccgagacgggcggggcgctgacgctgttcctggccaccgcgctgggcattccggtg
tcgaccacccacaccatcacgggcgcgatcgtcggcgtcggttcggtgcagcgtgcgagc
gcggtgcgctggggcgtggcgggcacgatcgtctgggcctggattttcacgatcccggcc
tcggcgttcgtggcggccgtggcctactggatcagccttcagatcttctag

DBGET integrated database retrieval system