KEGG   Variovorax sp. PAMC 28711: AX767_17060Help
Entry
AX767_17060       CDS       T04325                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
vaa  Variovorax sp. PAMC 28711
Pathway
vaa00071  Fatty acid degradation
vaa00072  Synthesis and degradation of ketone bodies
vaa00280  Valine, leucine and isoleucine degradation
vaa00310  Lysine degradation
vaa00362  Benzoate degradation
vaa00380  Tryptophan metabolism
vaa00620  Pyruvate metabolism
vaa00630  Glyoxylate and dicarboxylate metabolism
vaa00640  Propanoate metabolism
vaa00650  Butanoate metabolism
vaa00900  Terpenoid backbone biosynthesis
vaa01100  Metabolic pathways
vaa01110  Biosynthesis of secondary metabolites
vaa01120  Microbial metabolism in diverse environments
vaa01130  Biosynthesis of antibiotics
vaa01200  Carbon metabolism
vaa01212  Fatty acid metabolism
vaa02020  Two-component system
Brite
KEGG Orthology (KO) [BR:vaa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AX767_17060
   00630 Glyoxylate and dicarboxylate metabolism
    AX767_17060
   00640 Propanoate metabolism
    AX767_17060
   00650 Butanoate metabolism
    AX767_17060
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AX767_17060
   00072 Synthesis and degradation of ketone bodies
    AX767_17060
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AX767_17060
   00310 Lysine degradation
    AX767_17060
   00380 Tryptophan metabolism
    AX767_17060
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AX767_17060
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AX767_17060
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AX767_17060
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:vaa04147]
    AX767_17060
Enzymes [BR:vaa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AX767_17060
Exosome [BR:vaa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AX767_17060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AMM25873
UniProt: A0A126ZFI0
Position
3533357..3534541
Genome map
AA seq 394 aa AA seqDB search
MTSRDIFVVGTARTAIGTFGGSLKDVPNTQLATTAVKAALERSGVAPDAIGHVVMGNVIP
TDVKDAYLSRVAAIDAGCPIETPAFNVNRLCGSGLQAIVSAAQAIALGDCDIAIGGGSES
MSRGPYFDTAARYGARMGDAVLVDYMLGILHDPWEKMHMGITAENVAARYGITREQQDQL
AVMSQQRAAAAITAGRFKEQIVSVEVKTRKGVVLFDTDEHVRADTTMEALAKMKPAFKKD
GLVTAGNASGINDGAAAVVLAEGSRVQVLGLKPLARLVGYAHAGVEPAYMGIGPVPATRK
VLARTGLKVSDLDVIESNEAFAAQACAVIKELDFDPARVNPNGSGISLGHPVGATGAIIT
TKAIAELHRIGGRYALVTMCIGGGQGIAAIFERV
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgacttcacgcgacatcttcgtggtcggcactgcccgcaccgccatcggcaccttcggc
ggttcgctgaaggacgtgcccaacacccagctcgccaccacggcggtcaaggccgccctc
gaacgcagcggcgtggcgcccgacgccatcggccacgtggtcatgggcaacgtgatcccg
accgacgtgaaggatgcctacctgagccgtgtcgctgccatcgatgccggttgcccgatc
gagacgccggccttcaacgtgaaccgcctctgcggctccgggctgcaggcgatcgtgtct
gccgcgcaggcgatcgcgttgggagactgcgacatcgcgatcggcggtggttccgagtcg
atgagccgcggcccttacttcgacaccgcggcccgctatggcgcgcgcatgggcgacgcg
gtgctggtcgattacatgctcggtatcctgcacgacccctgggaaaagatgcacatgggc
atcaccgccgagaacgtggcggcgcgctacggcatcacgcgcgaacagcaggaccagctg
gcggtgatgagccagcagcgcgcggctgcggccatcacggcgggccgcttcaaggagcag
atcgtctcggtcgaagtgaagacacgcaagggcgtcgtgctgtttgacaccgacgagcac
gtacgcgccgacaccacgatggaagcgttggccaagatgaagccggctttcaagaaggac
ggtctcgtcaccgccggcaacgcgtcgggcatcaacgacggcgcggccgcggtggtgctg
gccgagggttcgcgcgtccaggtgctcgggctcaagccgctcgcgcgcctcgtgggttac
gcgcacgcgggcgtcgagccggcctacatgggcatcggcccggtgccggccacgcgcaaa
gtgctggcgcgcacggggctcaaggtgagcgacctcgacgtgatcgagtcgaacgaggcc
ttcgcggcgcaggcctgtgctgtcatcaaggaactggatttcgatccggcgagggtgaac
ccgaacggctccggcatttcgctcggccaccccgtgggcgcgaccggcgcgatcatcacg
accaaggcgatcgccgagctgcaccgtatcggtggccgctatgcgctggtgacaatgtgc
atcggcggcgggcagggcatcgctgcgatcttcgaacgcgtctga

DBGET integrated database retrieval system