KEGG   Variovorax sp. PAMC 28711: AX767_17310Help
Entry
AX767_17310       CDS       T04325                                 

Definition
(GenBank) succinyl-CoA--3-ketoacid-CoA transferase
  KO
K01029  3-oxoacid CoA-transferase subunit B [EC:2.8.3.5]
Organism
vaa  Variovorax sp. PAMC 28711
Pathway
vaa00072  Synthesis and degradation of ketone bodies
vaa00280  Valine, leucine and isoleucine degradation
vaa00650  Butanoate metabolism
vaa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vaa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    AX767_17310
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    AX767_17310
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AX767_17310
Enzymes [BR:vaa01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.5  3-oxoacid CoA-transferase
     AX767_17310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_trans AcetylCoA_hyd_C
Motif
Other DBs
NCBI-ProteinID: AMM25917
UniProt: A0A126ZFV8
Position
3582731..3583369
Genome map
AA seq 212 aa AA seqDB search
MPWTQDQMAARAADELEDGFYVNLGIGIPTLVANFVGDKEVWLQSENGMLGIGPFPTEDE
VDADLINAGKQTVTTLPGSAIFGSHDSFAMIRGGKINLSILGAMQVSSKGDLANWMIPGK
MVKGMGGAMDLVAGVKRVIILMEHVAKKKDGTEDMKILEACTLPLTGVGVVDRIITDLAV
IDVTPEGLKVVELAPGVTFEALQAKTGAALIR
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgccctggacccaagaccaaatggcagcgcgtgccgccgacgaacttgaagacggcttc
tacgtgaacctcggcatcggcatcccgacgctggtggcgaatttcgtcggcgacaaggaa
gtctggctgcagagcgagaacggcatgctcggcatcggtccgttcccgaccgaagacgag
gtcgatgctgacctgatcaacgccggcaagcagaccgtcaccaccttgccgggcagtgcc
atcttcggcagccacgacagcttcgcgatgatccgcggcggcaagatcaacctgtcgatc
ctcggcgccatgcaggtcagcagcaagggcgacctcgccaactggatgatcccgggcaag
atggtgaagggcatgggcggcgcgatggacctggtggccggcgtgaagcgcgtgatcatc
ctgatggaacacgtcgcgaagaagaaggacggcaccgaagacatgaagatcctcgaggcc
tgcaccttgccgctgaccggcgtgggcgtggtcgaccgcatcatcaccgacctcgcggtg
atcgacgtgacgcccgaaggcctcaaggtcgtcgaactggcaccgggcgtgaccttcgaa
gcgttgcaggcgaagacgggcgccgcgctgatccgctga

DBGET integrated database retrieval system