KEGG   Vagococcus sp. CF-49: E4Z98_05805Help
Entry
E4Z98_05805       CDS       T05932                                 

Gene name
gndA
Definition
(GenBank) NADP-dependent phosphogluconate dehydrogenase
  KO
K00033  6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Organism
vac  Vagococcus sp. CF-49
Pathway
vac00030  Pentose phosphate pathway
vac00480  Glutathione metabolism
vac01100  Metabolic pathways
vac01110  Biosynthesis of secondary metabolites
vac01120  Microbial metabolism in diverse environments
vac01130  Biosynthesis of antibiotics
vac01200  Carbon metabolism
Module
vac_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
vac_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:vac00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    E4Z98_05805 (gndA)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    E4Z98_05805 (gndA)
Enzymes [BR:vac01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.44  phosphogluconate dehydrogenase (NADP+-dependent, decarboxylating)
     E4Z98_05805 (gndA)
    1.1.1.343  phosphogluconate dehydrogenase (NAD+-dependent, decarboxylating)
     E4Z98_05805 (gndA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 6PGD NAD_binding_2 2-Hacid_dh_C Shikimate_DH F420_oxidored 3HCDH_N GP67 ApbA
Motif
Other DBs
NCBI-ProteinID: QCA28856
UniProt: A0A4P7Q9U1
Position
complement(1204535..1205938)
Genome map
AA seq 467 aa AA seqDB search
MKQQVGVVGMAVMGKNLALNIESKGYHVAIYNRTAEKTKLVIEENSDKNLWAAYDIEEFV
NNLETPRRIILMVQAGNPTDQMINQLLPFLEKGDILVDGGNTFFQDTRRRHKELADSGIH
FIGMGVSGGEEGALKGPALMPGGEEEAYRLIAPMLEKIAAKATDGKPCVAYMGGDGAGHF
VKMVHNGIEYGDMQLIAESYDLLRKLRGVSIESTADIFKEWNEGELDSFLIEITSNLLTK
QDEKAQQPLVEMILDSAGNKGTGKWTSQSALDLGVALPLVTEAVFARYISTIKDERVIAS
KLLFGPTIVEDKDNDELVEKIRQALYFSKIMSYAQGFAQYKVASETYNWQLNFGEIAQIF
REGCIIRARFLQKITEAYERNPELDNLLLDEYFIDITKRYQESAREVANLAIASGIPVPT
LSSAISYYDSYRSAQLPANIIQAQRDYFGAHTFKRVDMPGDFHANWY
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaacaagttggtgtagtcggtatggcggttatgggaaaaaatttagctttaaac
attgaaagcaaaggctatcatgtggcgatttataaccgaacagcagaaaaaacaaaatta
gtcattgaagaaaattcagataaaaatctatgggcggcttatgacatagaggaatttgtt
aataacttagaaacacctcgacgtattattttgatggtccaagcaggaaatcctaccgat
caaatgatcaatcaacttcttccatttttagaaaaaggggatatcttagtagatggcggt
aatacattcttccaagatactagaagacgtcataaggaattagctgattctggtattcat
tttattggaatgggtgtctctggtggcgaagaaggtgcattaaaaggacctgctttgatg
ccaggaggagaagaagaagcctatcgtttaattgccccaatgttagaaaaaatcgctgca
aaggcaacagatgggaaaccttgtgtcgcttatatgggtggagatggcgcgggtcacttt
gttaagatggttcataatgggattgaatacggcgatatgcagctaattgctgagtcttat
gacttacttcgtaaattaaggggtgtctcaatagagtcaactgccgatatttttaaagaa
tggaatgagggagaattggatagcttcctaattgaaatcacctctaacttattaactaaa
caagacgaaaaggcacaacagccgttagttgaaatgattttagatagtgcaggtaacaag
ggaacaggtaaatggacaagtcagagtgcattagatttaggtgtagcgttacctctggtt
actgaagccgtttttgcacgatacatttctacgataaaagacgagcgagtcattgctagt
aagttattatttggcccaacaattgtagaagacaaagataatgatgaattggtcgaaaaa
attagacaagcgttatatttcagtaagatcatgagctatgctcaagggtttgcccaatat
aaagtggctagtgaaacgtacaattggcagttgaattttggcgaaattgctcaaatattt
cgtgaaggttgcatcattcgtgcccgattcttacaaaaaattacagaggcctatgaacgt
aatcctgaattagataatttattgttagatgaatactttatcgatatcacgaaacgttat
caagaatctgcaagagaggtagcaaatttagcaattgcatcaggaattcctgtgccaaca
ttaagttcagctatttcttattatgattcttatcgcagtgctcaattacctgctaatatt
attcaagcacaaagagattattttggcgcacacacgtttaaaagagtcgatatgccaggc
gattttcatgctaattggtattaa

DBGET integrated database retrieval system