KEGG   Vagococcus sp. CF-49: E4Z98_07675Help
Entry
E4Z98_07675       CDS       T05932                                 

Gene name
nagA
Definition
(GenBank) N-acetylglucosamine-6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
vac  Vagococcus sp. CF-49
Pathway
vac00520  Amino sugar and nucleotide sugar metabolism
vac01100  Metabolic pathways
vac01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:vac00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    E4Z98_07675 (nagA)
Enzymes [BR:vac01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     E4Z98_07675 (nagA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3
Motif
Other DBs
NCBI-ProteinID: QCA29201
Position
complement(1585924..1587069)
Genome map
AA seq 381 aa AA seqDB search
MKYYVYADKFFLKSGTVGPAYLEVEDGVFGNVVNEIPEGAEVVDYSGKWIAPGLVDTHIH
GYMNHDVMDNDPEGIKIMSEALLSCGVTSYLPTTLTSDHELLTNVARTIGEVADEVDGAK
IQGIYFEGPFFTEKYKGAQNPAYMSDPSLEIFNKWQEESGGRIKKIALAPEREGVAEFVR
EVTNQGVVVALGHSDATVAQAQVAAENGASVFVHAFNGMSGLHHREPGMVGAVMTLHDVY
AELICDGHHVHPKAVDVLIKTKGHDHIALITDCMMAGGMPDGEYMLGEFPVVVAEGTARM
AEGNLAGSILKLKEALKNVVEWGVATPEQAVMMASLIPAVSCNIEDKCGSITPGREADFI
VLSPTMDLEATYLDGVVRYEA
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgaaatattatgtttatgcagataaatttttcttaaaaagtggaacagtaggaccagcg
tatttagaggtagaagatggcgtatttggtaatgttgttaacgaaattcctgaaggggca
gaagttgttgattattcaggtaaatggattgcgccaggcctagttgatacgcacattcac
ggatatatgaaccatgatgtcatggataacgatccagagggtattaaaattatgtcagaa
gctttactttcttgtggggtgacgtcttatttaccgacaacattaacgtctgatcatgag
ttattaacaaacgttgcacgtaccattggtgaagtagccgatgaagtagatggagctaaa
attcaagggatttattttgaaggaccattctttactgaaaaatataaaggagcccaaaat
cctgcttacatgagtgaccctagtttagaaatctttaacaaatggcaagaagaatcaggt
ggacgcattaagaaaatcgctttagcaccagagcgcgaaggtgttgcggaattcgtccgt
gaagtaactaatcaaggagtagttgttgcgttaggtcatagtgatgcgacggttgctcaa
gcacaagtagccgctgagaatggtgccagtgtgtttgttcatgcttttaacggaatgagt
ggtttacaccaccgtgaaccaggaatggtcggtgcggtgatgacgttacatgatgtctat
gcagagttgatttgtgatggtcaccacgtccatcctaaagcggtagatgtattgattaag
acaaaaggtcatgatcatattgcgttgattactgactgtatgatggctggaggaatgcct
gatggtgaatatatgttaggtgaattcccagtagttgtggctgaaggaacagcacgtatg
gcagaaggtaacttggccggaagtattttaaaattaaaagaagcattgaaaaatgttgtt
gagtggggtgttgctacaccagaacaagcagtaatgatggcttctttaattccagcagtt
agctgtaatattgaagataaatgtggttcaattacgccaggtcgtgaggcagatttcatc
gtattatcaccaactatggacttagaagcgacatatttggacggagtagtaagatacgaa
gcataa

DBGET integrated database retrieval system