KEGG   Vibrio alfacsensis: D1115_10515Help
Entry
D1115_10515       CDS       T05841                                 

Definition
(GenBank) 23S rRNA (guanine(745)-N(1))-methyltransferase
  KO
K00563  23S rRNA (guanine745-N1)-methyltransferase [EC:2.1.1.187]
Organism
vaf  Vibrio alfacsensis
Brite
KEGG Orthology (KO) [BR:vaf00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:vaf03009]
    D1115_10515
Enzymes [BR:vaf01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.187  23S rRNA (guanine745-N1)-methyltransferase
     D1115_10515
Ribosome biogenesis [BR:vaf03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    D1115_10515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_31 Methyltransf_25 Methyltransf_11 Methyltransf_23 Methyltransf_32 Methyltransf_12 Ubie_methyltran MTS CMAS Methyltransf_33 DLH Pox_I3 zf-MIZ
Motif
Other DBs
NCBI-ProteinID: AXY01527
UniProt: A0A347URP8
Position
I:2157837..2158679
Genome map
AA seq 280 aa AA seqDB search
MNYQCPLCHQPLALTAKTFKCENNHQFDLAKEGYVNLMPAHHKRSKDPGDNKEMMQARRR
FLEGNHYDPMRQEVARLCTKYTEGTEHQLLDIGCGEGYYTNQVHQSLRAQSDDASVYGLD
ISKIAIRYASKRYPNCDFSVASSHRLPFSDNSLDAILRIYAPCKAEELQRVIKDNGVIIT
VTPAARHLYQLRERIYQDVRMHNEEPEAIEGFELEHQQQLNYEMALKDATAFDLLQMTPL
AWKASDELREELKSTTLFKCEADFMLRVYRKKSVNVVNED
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgaactatcaatgccccctatgccatcagcctttagcactcaccgcgaagacgtttaag
tgtgaaaacaaccaccaatttgatttagcaaaagaaggctacgtcaatttgatgcctgcg
caccataaacgctcaaaagatccgggtgataacaaagagatgatgcaagcacgtcgtcgc
ttcctagagggaaaccattacgatccaatgcgtcaagaagtcgctcgtctttgcacgaaa
tatacagaggggactgaacaccagctattagacatcggctgtggagagggctactacacc
aaccaagttcatcaatctttgcgagcgcaaagtgacgatgcatctgtatacggtttggat
atttcaaagattgccattcgttacgcttctaagcgttatccaaattgtgatttcagcgtt
gcttctagccatcgacttccattttcagacaactcgctagatgccattttacgaatttat
gcaccatgtaaagccgaagagctacagcgcgtgatcaaagacaatggcgtgatcattacc
gtcacacctgctgcgcgtcacctctatcaattacgcgaacgtatttaccaagatgtccga
atgcacaatgaagagccagaggccattgagggctttgagctcgagcatcaacagcagctc
aattacgaaatggcactcaaagatgcaaccgcttttgatttactacaaatgacgccttta
gcttggaaagcgagcgatgaactccgcgaagaattaaagtccactacactatttaagtgt
gaggcagactttatgttgcgtgtttaccgtaaaaaatccgtaaatgtggtcaatgaagat
taa

DBGET integrated database retrieval system