KEGG   Vibrio alfacsensis: D1115_11780Help
Entry
D1115_11780       CDS       T05841                                 

Gene name
rlmM
Definition
(GenBank) 23S rRNA (cytidine(2498)-2'-O)-methyltransferase RlmM
  KO
K06968  23S rRNA (cytidine2498-2'-O)-methyltransferase [EC:2.1.1.186]
Organism
vaf  Vibrio alfacsensis
Brite
KEGG Orthology (KO) [BR:vaf00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:vaf03009]
    D1115_11780 (rlmM)
Enzymes [BR:vaf01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.186  23S rRNA (cytidine2498-2'-O)-methyltransferase
     D1115_11780 (rlmM)
Ribosome biogenesis [BR:vaf03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    D1115_11780 (rlmM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RlmM_FDX FtsJ Spt5-NGN
Motif
Other DBs
NCBI-ProteinID: AXY01715
UniProt: A0A347US86
Position
I:complement(2405443..2406534)
Genome map
AA seq 363 aa AA seqDB search
MKQLMLYCRAGFEKECAGEIQDKATQLEVYGFSRVKKNSGYVVFECYQDGDADKLAKSLD
FSALIFARQMFAVAAEFESLPSEDRISPILAELSEVASFPRCGDLRIETPDTNEAKELLK
FCRKFTVPMRQAMRGKGLMWNKDNAKKPVLHICFVAPGHCYVGYSYPGNNSQFFMGIPRL
KFPADAPSRSTLKLEEAFHVFIPREEWDERLAPGMWGVDLGACPGGWTYQLVKRSMFVHC
VDNGMMADSLMETGQIKHHMVDGFKFEPDRKNVTWIVCDMVEKPARVAHLMGQWLLKGWA
KEAIFNLKLPMKGRYDEVLQDLENLKMFLIENKVKFKLQAKHLYHDREEITIHIQCLSNI
SPH
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacaactaatgctctattgccgtgctggctttgagaaagagtgtgctggtgaaatt
caggacaaagcaacacagttggaagtgtatggcttctctcgtgtgaagaaaaactcaggt
tatgttgtctttgagtgttaccaggatggagacgccgataaactagcaaaaagcttagat
ttcagtgcgctgatttttgctcgtcaaatgtttgccgttgctgctgagtttgaatcgtta
ccaagtgaagaccgcattagcccaattcttgctgagttgtctgaagtggcatcatttcct
cgttgtggtgatttacgtattgaaactccagatacgaatgaagcgaaagagctgttgaag
ttctgtcgcaagtttaccgtaccgatgcgccaagcaatgcgcggtaaaggtctgatgtgg
aacaaagacaacgcgaaaaaaccagtgctgcacatctgttttgtagcgccaggtcactgc
tacgtgggttactcatacccgggtaacaactcgcagttcttcatgggtattcctcgcctt
aagtttccagcagacgcgccaagccgttcaacactgaaactggaagaagcttttcacgtc
tttattcctcgtgaagagtgggatgagcgtctagcaccgggtatgtggggcgttgaccta
ggtgcgtgtccaggtggttggacttaccaattggtgaagcgttcgatgttcgttcattgt
gttgataacggtatgatggcagacagccttatggaaacgggtcaaatcaagcaccacatg
gtggacggctttaagtttgaacctgaccgcaagaacgtaacctggattgtgtgcgatatg
gttgagaaaccagcacgcgtggcgcacttgatgggacaatggctgctgaaaggctgggct
aaagaagcgatctttaacttgaagttaccaatgaaaggtcgttacgatgaggtacttcaa
gatcttgagaacttaaaaatgttcctgatcgagaataaagtgaagtttaagctgcaagct
aagcacctgtaccatgaccgtgaggaaatcacgattcacatccagtgcctatcgaacatt
tctccgcattaa

DBGET integrated database retrieval system