KEGG   Vibrio alfacsensis: D1115_11850Help
Entry
D1115_11850       CDS       T05841                                 

Gene name
ribB
Definition
(GenBank) 3,4-dihydroxy-2-butanone-4-phosphate synthase
  KO
K14652  3,4-dihydroxy 2-butanone 4-phosphate synthase / GTP cyclohydrolase II [EC:4.1.99.12 3.5.4.25]
Organism
vaf  Vibrio alfacsensis
Pathway
vaf00740  Riboflavin metabolism
vaf00790  Folate biosynthesis
vaf01100  Metabolic pathways
vaf01110  Biosynthesis of secondary metabolites
Module
vaf_M00125  Riboflavin biosynthesis, GTP => riboflavin/FMN/FAD
Brite
KEGG Orthology (KO) [BR:vaf00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    D1115_11850 (ribB)
   00790 Folate biosynthesis
    D1115_11850 (ribB)
Enzymes [BR:vaf01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     D1115_11850 (ribB)
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.12  3,4-dihydroxy-2-butanone-4-phosphate synthase
     D1115_11850 (ribB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHBP_synthase GTP_cyclohydro2
Motif
Other DBs
NCBI-ProteinID: AXY01728
UniProt: A0A347US99
Position
I:complement(2418563..2419672)
Genome map
AA seq 369 aa AA seqDB search
MPISTPQEIIDDIRAGKMVILMDDEDRENEGDLIMAAEHITPEAINFMATYGRGLICLTM
TKTRCESLGLPPMVQDNNAQYTTNFTVSIEAAEGVTTGISAADRARTVQAAVASNAKASD
LVQPGHIFPLAAQDGGVLTRAGHTEAGCDLARLAGLEPASVIVEILNDDGTMARRPDLEV
FAEKHGLKLGTIADLIEYRNNTETTIERVAECKLPTEYGEFKLVTYKDTIDNQVHYAMQN
GDLTEEAPLVRVHLQDVFTDVLRSDRNAERSWTLDKAMKRIGEEGGVLVVLGHEDSTDLL
IHRVKMFEAQDKGEAPTLAKKQGTSRRVGVGSQILADLGVHDMRLLSSTNKKYHALGGFG
LNVVEYVCE
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgccaatcagcacgccacaagaaattattgatgatattcgcgcgggtaaaatggtcatc
ttgatggatgacgaagatcgtgagaacgagggcgacctgatcatggctgccgaacatatc
acacctgaagccattaactttatggcgacatatggtcgtggattgatctgtctgaccatg
acaaaaactcgctgtgaaagcctaggcttaccaccgatggtgcaagacaataatgcacag
tacaccactaacttcacggtttctattgaagcagctgaaggggtaacgacgggtatttct
gcggcggatcgtgctcgcactgtgcaagctgcggttgcatcaaatgcaaaagcatcggat
ttggtgcaaccggggcatattttcccacttgcagcacaagacggtggagtgttgactcgc
gcaggccatactgaagcgggttgtgatttggcgcgtctagcagggcttgaaccagcatca
gtcattgttgaaatcttaaatgacgatggcacgatggcacgacgtcctgatcttgaagtt
tttgccgaaaaacacggtttgaagttaggtacaatcgcggatcttatcgaataccgtaac
aacacggaaaccacgattgagcgtgtggcagaatgtaagctgccaacggagtatggtgag
ttcaagttggtgacctataaagataccatcgacaatcaagttcattacgcaatgcaaaat
ggcgatttaactgaggaagcaccattggttcgagtgcatcttcaagatgtctttactgat
gttcttcgcagtgatcgtaatgccgagcgcagttggacgctagataaagcgatgaagcgt
atcggtgaagaggggggtgtcctcgtggttctcggccatgaagactcaacagatttgctg
attcaccgcgtaaaaatgtttgaagcgcaagataaaggtgaagcgccaacgcttgcaaag
aaacaaggtacatcgcgccgcgtaggtgtggggtctcaaatcctagcagatttgggggtt
catgatatgcgtctactgtcttcaacgaataaaaaataccacgcattaggcggatttggc
ttaaacgtggttgaatacgtctgcgagtaa

DBGET integrated database retrieval system