KEGG   Vibrio alginolyticus: N646_1036Help
Entry
N646_1036         CDS       T02840                                 

Definition
(GenBank) hypothetical protein
  KO
K07053  3',5'-nucleoside bisphosphate phosphatase [EC:3.1.3.97]
Organism
vag  Vibrio alginolyticus
Brite
KEGG Orthology (KO) [BR:vag00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    N646_1036
Enzymes [BR:vag01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.97  3',5'-nucleoside bisphosphate phosphatase
     N646_1036
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHP
Motif
Other DBs
NCBI-ProteinID: AGV16869
UniProt: A0A2I3C6M8
Position
1:complement(1107912..1108769)
Genome map
AA seq 285 aa AA seqDB search
MRIDLHSHTTASDGRLEPKDLVERALSFDIEVLAITDHDTVDGLALAKQYVQDNNLPIKI
INGIEISTVWQNKDIHIVGLNIDPENEQLSALIEQQKQHRITRSELIAERLQKATRVGVL
EEVRQIAGDAPVTRAHFAKWLVDNGYAKTMQMVFKKYLTRNNPGYVPPNWCSMKDAVDAI
HAAGGMAVLAHPGRYKLTAKWIKRLLAAFVEAGGDAMEVAQPQQAQQERRNLADYAIQYK
LLASQGSDFHYPSPWMELGRNLWLPAGVEPVWKDWGIDPSLNNTQ
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgagaattgatttacatagtcacaccactgcatcggacggtcggttagaacctaaagat
ttagtggaaagggcgctgagttttgatatcgaggttttggcgatcactgatcacgatacg
gttgacggtttggcgttagctaagcaatacgttcaagataataatttgccgataaaaatc
atcaatggcattgagatatcgaccgtctggcaaaacaaagacattcatattgtcggcctg
aatattgatccggaaaatgaacaattatctgccctcatagaacagcagaagcagcatcgc
ataacacgatctgagttaattgcagagcgactacaaaaagcaactcgagtaggtgtgctt
gaagaggtaaggcaaatcgccggtgatgctccagtgacaagagcgcatttcgcgaaatgg
ttggtagataatggttacgcaaaaaccatgcaaatggtgtttaaaaaatacctaacgcgt
aataacccaggttatgtaccaccgaattggtgttcgatgaaggatgcggttgatgctatc
catgcggctggtggaatggcggtattagcgcatcctggcagatataagttgacagcgaag
tggattaagcgtcttctagcagcgtttgtcgaagcaggtggtgatgcgatggaagttgca
cagccacagcaagcgcaacaagaaaggcgcaacttggctgattatgctatacaatacaaa
ctattagcctctcaaggcagtgattttcactacccatcaccgtggatggagctaggaagg
aacctatggttgcctgctggcgtcgaaccagtttggaaagattggggaatagatccttcg
ttgaataatactcagtaa

DBGET integrated database retrieval system