KEGG   Vibrio alginolyticus: N646_2013Help
Entry
N646_2013         CDS       T02840                                 

Definition
(GenBank) glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
vag  Vibrio alginolyticus
Pathway
vag00471  D-Glutamine and D-glutamate metabolism
vag01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vag00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    N646_2013
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:vag01011]
    N646_2013
Enzymes [BR:vag01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     N646_2013
Peptidoglycan biosynthesis and degradation proteins [BR:vag01011]
 Precursor biosynthesis
  Racemase
   N646_2013
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race
Motif
Other DBs
NCBI-ProteinID: AGV17832
UniProt: A0A2I3CC19
Position
1:complement(2187929..2188732)
Genome map
AA seq 267 aa AA seqDB search
MRVASKKKVLVFDSGVGGLSVFQEIHRLLPQLDYLYLFDNQAYPYGELDQAVLVSRVNQL
VSSLVEEHQVDIVVIACNTASTIVLPSLRENLSIPVVGVVPAIKPASLLASKGVGLIATP
ATVTRQYTHELIRDFAQGKPVELVGSTRLVDMAEEKLRGNSVSLDELTNILLPLRDKVDV
AVLGCTHFPLIREEIHQALGGDVTLIDSGAAIARRVKALLLSDEIEDTEEGSKSIYASAT
PWQEDALNICLKKLGFNPVQVYHHPDV
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
gtgcgagtagcaagtaagaaaaaagtcctagtttttgactctggtgttggtggtctttct
gtattccaagagatacatcgcctattgccccagctagactacttatacttattcgataat
caggcttacccttatggtgaactcgatcaggctgtactcgtttcacgagttaaccaactg
gtctcttctttagtcgaagaacaccaagtcgacattgtcgtcattgcttgcaacacggcg
agcaccatagtgcttccttccttacgcgaaaatttatcgattcccgttgttggtgttgtc
cctgcgattaaacccgcatcgcttttagcatcaaaaggggtagggctgatcgccactccg
gcgacagtaacacgccaatatactcacgagttaatacgggactttgcgcaaggcaaacca
gttgagctggtgggatcaactcgcttggtagatatggccgaagagaagttgcgaggcaac
agcgtttctctcgacgaactgacaaatatcctgcttccccttcgcgataaagtcgatgtt
gcggtgctcggttgtactcacttccctttaatcagagaggagattcatcaagctttgggt
ggggacgttactttaattgattcaggcgcagcgattgcacgtcgagtaaaagcattgcta
ttaagtgatgaaattgaggatacagaagagggaagtaagtcgatttatgccagtgcaact
ccttggcaggaagatgcactgaacatttgtttaaagaagctaggttttaatcctgttcag
gtttaccaccatccggatgtttag

DBGET integrated database retrieval system