KEGG   Vibrio alginolyticus: N646_2302Help
Entry
N646_2302         CDS       T02840                                 

Definition
(GenBank) oxygen-independent coproporphyrinogen III oxidase
  KO
K02495  oxygen-independent coproporphyrinogen III oxidase [EC:1.3.98.3]
Organism
vag  Vibrio alginolyticus
Pathway
vag00860  Porphyrin and chlorophyll metabolism
vag01100  Metabolic pathways
vag01110  Biosynthesis of secondary metabolites
Module
vag_M00121  Heme biosynthesis, plants and bacteria, glutamate => heme
Brite
KEGG Orthology (KO) [BR:vag00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    N646_2302
Enzymes [BR:vag01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.98  With other, known, physiological acceptors
    1.3.98.3  coproporphyrinogen dehydrogenase
     N646_2302
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM HemN_C
Motif
Other DBs
NCBI-ProteinID: AGV18114
UniProt: A0A2I3CDB6
Position
1:2491266..2492657
Genome map
AA seq 463 aa AA seqDB search
MSNQHTESKQQIVWDQAVLDKYNYSGPRYTSYPTALEFHEAFTISDYDMACTQYPERPLS
LYVHIPFCHKLCYYCGCNKVITRHSHKADEYLDVLEHEIRQRAALLVGRTVTQLHFGGGT
PTFLSEKQITRVMSLLRQEFTFSSDAEISIEVDPREIELTMLDHLRSEGFNRLSIGVQDF
NKEVQKLVNREQDEEFIVAMVARAKELGFRSTNLDLIYGLPKQTKESFAKTLEQVLEMQP
GRLSVFNYAHMPQLFAAQRKIKDEDLPKAEEKMAILQDTIATLTDAGYQFIGMDHFALPD
DELAVAQREGILHRNFQGYTTQGECDLVGFGVSAISMIGDAYAQNQKELKKYYAQVNELR
HALWKGVSLDSDDLLRREVIKQLICNFKLDKKAIESEFKVRFEQYFKEDLQLLQTFINDE
LVEVDDNEIRVTLRGRLLIRNICMSFDKYLRAKARQQQFSRVI
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaatcaacacactgaatcgaaacagcaaatcgtctgggatcaagcggtattggat
aagtacaactattccgggcctcgttatacgtcgtacccaacggcgctggagtttcatgaa
gcgttcaccatttctgattatgatatggcatgcactcaatacccagaacgcccattatcg
ctgtacgtacacattccgttctgtcacaagctttgttactactgtggatgtaataaagtc
attacacgccattcgcacaaagcggatgaatacctcgacgtgcttgaacacgaaattcgt
caacgtgctgcattacttgttggtcgcaccgtgacgcaattgcattttggtggtggtaca
ccgacgtttctctctgaaaagcaaatcacgcgtgtaatgagcctgctacgccaagagttt
acttttagtagcgatgctgaaatcagtatcgaggttgacccgcgtgaaatcgagctgacc
atgctggatcatctgcgtagtgaaggcttcaatcgcttgagcatcggtgttcaggacttc
aacaaagaagtgcaaaagctggtgaatcgtgagcaagatgaagagttcatcgttgcgatg
gttgcgcgcgcaaaagagttaggctttcgttcgacgaacctagatttaatttacggttta
ccgaagcagaccaaagaatcttttgccaagactctagaacaagtgctagagatgcagccg
ggccgtctatccgtgtttaactacgcgcacatgccacagctatttgcagcgcagcgtaag
attaaagacgaagacctgccaaaggcagaagagaagatggcgattctgcaagacaccatc
gcgacactgactgatgctggctaccaatttatcggtatggaccactttgctttgccggac
gatgaacttgctgttgcccagcgcgaaggtattttgcatcgcaatttccaaggctacacc
acacaaggtgaatgtgacttggttggctttggtgtttctgcaatctcgatgatcggcgat
gcgtacgcgcaaaaccagaaagagctgaagaaatactacgctcaagtcaacgaacttcgt
cacgctctatggaaaggggtctctctggactccgatgatttgctccgtcgcgaagtgatt
aagcagctgatttgtaacttcaagttagacaagaaagccattgagtctgagtttaaagtg
aggtttgaacagtactttaaagaagatttgcagctacttcagacctttattaacgatgag
ctggtggaagtggatgacaatgaaattcgtgtgacgctgcgaggtcgtttgttgatccgt
aatatttgtatgagcttcgataaatacctacgagcaaaggcacgtcagcaacagttctct
cgtgttatttaa

DBGET integrated database retrieval system