KEGG   Vibrio alginolyticus: N646_2524Help
Entry
N646_2524         CDS       T02840                                 

Definition
(GenBank) hypothetical protein
  KO
K06195  ApaG protein
Organism
vag  Vibrio alginolyticus
Brite
KEGG Orthology (KO) [BR:vag00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    N646_2524
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354
Motif
Other DBs
NCBI-ProteinID: AGV18336
UniProt: A0A2I3CED7
Position
1:complement(2707046..2707426)
Genome map
AA seq 126 aa AA seqDB search
MDVIQPCIKIQVHTKYIEEQSNPELQRYVFAYIITIKNLSQQTVQLVSRRWLITDSNGKQ
MTVEGDGVVGQQPFIPSNDEYTYSSGTALETPVGVMQGHYKMLDEKGQEFITEIEPFRLA
VPNVLN
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atggacgtcattcaaccttgcatcaaaattcaagttcacaccaaatacatcgaagaacag
tccaacccagagctacaacgctacgttttcgcttatatcatcaccatcaaaaaccttagc
cagcaaaccgtacagttagtgagccgccgctggctaatcacagactcgaatggcaagcaa
atgacggttgaaggtgacggagtggtaggccagcagccctttattccaagcaatgatgaa
tacacgtacagtagcggaaccgcgttagaaacccctgtcggcgttatgcaaggacactac
aaaatgctggatgagaaagggcaagagttcatcaccgaaatcgaaccatttcgcttggct
gttccaaatgttttaaattag

DBGET integrated database retrieval system