KEGG   Vibrio alginolyticus: N646_3437Help
Entry
N646_3437         CDS       T02840                                 

Definition
(GenBank) proline dehydrogenase/delta-1-pyrroline-5-carboxylate dehydrogenase
  KO
K13821  RHH-type transcriptional regulator, proline utilization regulon repressor / proline dehydrogenase / delta 1-pyrroline-5-carboxylate dehydrogenase [EC:1.5.5.2 1.2.1.88]
Organism
vag  Vibrio alginolyticus
Pathway
vag00250  Alanine, aspartate and glutamate metabolism
vag00330  Arginine and proline metabolism
vag01100  Metabolic pathways
vag01110  Biosynthesis of secondary metabolites
vag01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:vag00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    N646_3437
   00330 Arginine and proline metabolism
    N646_3437
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:vag03000]
    N646_3437
Enzymes [BR:vag01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     N646_3437
  1.5  Acting on the CH-NH group of donors
   1.5.5  With a quinone or similar compound as acceptor
    1.5.5.2  proline dehydrogenase
     N646_3437
Transcription factors [BR:vag03000]
 Prokaryotic Type
  Ribbon-helix-helix
   Other families
    N646_3437
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh Pro_dh Pro_dh-DNA_bdg PRODH
Motif
Other DBs
NCBI-ProteinID: AGV19247
UniProt: A0A2I3CKV3
Position
2:complement(394069..397200)
Genome map
AA seq 1043 aa AA seqDB search
MFTATNVLTPEFIGQPLDKLWSLISPLYMVDESQWLEQLLPLATPTEDEKSAITTQTTHL
IEAIRADKKSIQMIDALLLEYSLDTQEGILLMCLAEALMRIPDAATADSLIKDKLSVADW
KSHLKNSDSVFVNASTWGLMLTGKVVGLGEQGTQSPGQAVNRLVNKFSEPVIRKAMYQAM
KIMGHQFVRGRTIEEAQKNGRPMRDKGFTYSFDMLGEAALTTADANKYFKDYLMAIEAVG
RETYGNDTSPAPSISIKLSALHPRYEVANEERVMTELYDSLMQLLKRAIEVDVAITIDAE
EADRLELSLKLFEKVYRSDLVKGWGKFGLVIQAYSKRALPVLVWLNALAKEQGDVIPLRL
VKGAYWDSEIKWSQQAGYANYPVYTRKEATDVAYLACARFLLSEGVRGNIYPQFASHNAH
TVTAIAVMAEHKEYEFQRLHGMGDSLYNHVMKMYGQPVRIYAPVGSHADLLPYLVRRLLE
NGANSSFVHRLVDARCPIYELTHHPVDVLTGFDTLHNDKIPLPADIFPERKNSYGVNIDI
DSEAKPFEAQVESFMDNQWVAGPMINGERFAESMIKENAAEIITAPYDRRIEVGKVAFAT
LDHVSAAIDAAQTAFSDWKAVPVEQKAACLEKLADLMEENLAELVAICHKEAGKTIHDSI
DEVREAVDFCRYYAKQAQNLQPFELEGFDGVKRISSREGLGVFVCISPWNFPLAIFLGQV
TAALIAGNTVVAKPAEQTSLIAARAIELMLDAGFPAGVIQLLTGRGAEIGHALTSHDAIA
GVAFTGSTATAQRINVTLAERSAKPVPFIAETGGQNAMIVDSTALPEQVVRDVIRSAFAS
AGQRCSALRVLFVQEDVADRMINLIQGAMNELHVGLPYLHKTDVGPVIDSNAKQKLLAHL
EQMSKTQTKVAQLQLDESCQHGDFVSPSAFEISGIDVLKEEQFGPILHIVRFKASELPNV
VAQINRTGFGLTMGIHSRNETTYRWIEKHARVGNCYINRDQVGAVVGVQPFGGQGLSGTG
PKAGGPHYLFRFTQHLLAQAENA
NT seq 3132 nt NT seq  +upstreamnt  +downstreamnt
atgtttacagctacgaacgtgttgacaccggaatttatcgggcagccgcttgataagttg
tggtcactgatctcgccattatatatggtggacgagtctcaatggctagagcaactattg
ccactagcgacgccgacagaggatgaaaaatcggcgatcactacccaaacgacccacctt
atcgaagccattcgtgccgataagaagtcaatccagatgattgatgctttattgctggaa
tacagcttagatactcaagaaggtatcttgctgatgtgtcttgcagaagcattaatgcgc
atcccagatgccgcgacagcagattctttgattaaagataagttgagtgtcgcagactgg
aaatctcacctgaaaaactctgactctgtgtttgttaacgcatcaacatggggcctcatg
ctaacaggtaaagtggttggtcttggtgagcaaggcacccagagcccaggtcaggctgta
aaccgtctggtaaataaattctctgagcccgtgattcgtaaagccatgtatcaggcaatg
aagatcatgggtcaccagtttgttcgtggtcgtacgatcgaagaagcgcaaaagaacggt
cgtccgatgcgcgacaaaggtttcacctactcgtttgatatgttgggtgaggcggcgtta
actacagcggacgcgaacaagtacttcaaagattacctaatggcgatcgaagcggtgggt
cgcgagacttacggtaacgacaccagccctgcgccttcgatttccatcaagctttctgca
ttacatccgcgctacgaagtcgcaaatgaagaacgtgtaatgacagagttgtatgactca
ctaatgcaactactaaaacgtgctattgaagtcgacgttgcaatcacaatcgatgcagaa
gaagcggatcgccttgagctttctctgaagctatttgagaaagtgtaccgtagcgatctt
gtgaaaggttggggcaagtttggtttggttattcaagcctactcaaaacgtgcgctacca
gtcttggtgtggctaaatgcactcgcaaaagagcaaggtgacgttattcctctgcgtttg
gttaaaggcgcgtactgggacagcgaaatcaagtggtctcaacaagcgggttatgcaaac
tacccagtatacactcgcaaagaagcgacggacgttgcatacctagcttgtgctcgtttc
ctacttagcgaaggtgttcgcggtaatatctacccacaatttgcaagccacaatgctcac
acagttacggcaattgctgtcatggcggagcacaaagaatacgagttccagcgcctgcat
ggtatgggtgattcactgtataaccatgttatgaaaatgtacggtcagccagtacgtatt
tatgctcctgtcggtagccatgctgatcttcttccgtacttggttcgtcgtctgcttgaa
aatggtgcgaacagctcgtttgtacaccgtctagttgatgcgcgttgtccgatttatgag
ttgactcatcaccctgtggatgtgttgacgggttttgacacgctacacaacgacaaaatt
ccattgcctgccgatattttccctgagcgtaagaactcatatggcgtcaacatcgacatc
gacagtgaagcgaagccatttgaagctcaggtcgaaagcttcatggacaatcagtgggtt
gcaggcccgatgatcaatggtgaacgctttgccgaaagcatgatcaaggaaaatgcggct
gagatcatcaccgcaccatacgatcgccgaattgaagtcggcaaagtggcatttgcaact
cttgatcacgtttccgctgcaattgatgcggcgcaaactgctttctctgattggaaagcc
gttcctgtagaacaaaaagcggcttgtttagaaaagcttgctgacttaatggaagaaaac
ctggctgagctggtggcgatttgtcacaaagaagcgggcaaaacgattcacgatagcatt
gatgaagttcgtgaagcggtggatttctgtcgttattacgcgaaacaagcgcaaaaccta
cagccatttgagctagaaggctttgatggtgtgaaacgcatttctagccgtgaaggtctt
ggtgtgtttgtgtgtattagcccttggaacttcccgttggctatcttccttggtcaggtg
acggcagcactgattgcgggtaacacagtggttgcaaaacctgctgagcaaacaagctta
attgccgctcgcgctattgaactaatgcttgatgctggtttccctgcaggtgtgattcag
ttacttactggtcgcggcgctgagattggtcatgcactgacttctcatgatgctattgct
ggtgtggcattcactggctcaacggcaacggcgcaacgcattaacgtcacgcttgcggag
cgcagcgcgaaaccggttccgtttattgcggaaacaggtggtcaaaacgcaatgatcgtg
gacagtactgcattgccagagcaggtggtgcgtgatgtgattcgttcggcgtttgcatct
gcaggtcagcgttgttctgcccttcgtgttctatttgtacaagaagatgtagcagaccgt
atgatcaacctgattcaaggtgcgatgaatgagctgcatgttggtttaccttacctacac
aaaacggatgttggtccggttatcgacagcaatgcaaaacaaaaactcctcgctcacctt
gagcaaatgagcaaaacacagactaaagtcgctcagctacagctggatgaatcgtgccag
catggtgactttgtctcaccaagtgcgtttgaaatctcgggcatcgatgtgctgaaagaa
gaacaatttggtccaatcttgcacattgttcgctttaaagcgtctgaattaccgaacgtg
gttgcgcagatcaacagaacgggttttggcttgacgatgggtatccatagccgtaacgaa
accacgtaccgttggattgagaaacatgcacgagtaggtaactgctatatcaaccgagac
caagttggcgctgtggttggtgtacagccgtttggtggtcaaggcttgtcgggtactggc
ccgaaagctggtggtccacactacctattccgctttactcaacatcttcttgctcaagca
gaaaacgcataa

DBGET integrated database retrieval system