KEGG   Vibrio alginolyticus: N646_3909Help
Entry
N646_3909         CDS       T02840                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
vag  Vibrio alginolyticus
Pathway
vag00071  Fatty acid degradation
vag00072  Synthesis and degradation of ketone bodies
vag00280  Valine, leucine and isoleucine degradation
vag00310  Lysine degradation
vag00362  Benzoate degradation
vag00380  Tryptophan metabolism
vag00620  Pyruvate metabolism
vag00630  Glyoxylate and dicarboxylate metabolism
vag00640  Propanoate metabolism
vag00650  Butanoate metabolism
vag00900  Terpenoid backbone biosynthesis
vag01100  Metabolic pathways
vag01110  Biosynthesis of secondary metabolites
vag01120  Microbial metabolism in diverse environments
vag01130  Biosynthesis of antibiotics
vag01200  Carbon metabolism
vag01212  Fatty acid metabolism
vag02020  Two-component system
Brite
KEGG Orthology (KO) [BR:vag00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    N646_3909
   00630 Glyoxylate and dicarboxylate metabolism
    N646_3909
   00640 Propanoate metabolism
    N646_3909
   00650 Butanoate metabolism
    N646_3909
  09103 Lipid metabolism
   00071 Fatty acid degradation
    N646_3909
   00072 Synthesis and degradation of ketone bodies
    N646_3909
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    N646_3909
   00310 Lysine degradation
    N646_3909
   00380 Tryptophan metabolism
    N646_3909
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    N646_3909
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    N646_3909
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    N646_3909
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:vag04147]
    N646_3909
Enzymes [BR:vag01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     N646_3909
Exosome [BR:vag04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   N646_3909
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AGV19718
UniProt: A0A2I3CP34
Position
2:878866..880077
Genome map
AA seq 403 aa AA seqDB search
MMEKVFIVAAKRTPIGAFGGSLKNTSAGDLAAVAIKGALEAAKLPGDKVDEVIVGNVVGA
GQGMGVGRQAALFAGIPESVPAYGVNMVCGSGMKTVMDAVSHIRSGDAEIVVAAGVEVMS
QIPFAAPSSIRDGNKMGNLELKDLLVADGLTDVYNQYHMGVTAENVAKQIGLTRQQQDEY
ALSSQQKAVAAIEAGKFQDEIVPVEVKQRRETVMFDTDEYPKANATMEALSKLRPAFDRE
GTVTAGNASGINDGASAIIVASESAVKAHGLTPLAEIVSYAQSGLDPKIMGLGPVESVNK
ALEKAELTVNDIDVYELNEAFAAQALGVIHQLAETNQVPVNAIQDKANFNGGAIALGHPL
GASGNRILVTLVHELHKQNGQYGVASLCVGGGMGTAVVVKTVK
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgatggaaaaagtatttatcgtagcggcgaagcgtactccaattggtgcttttggtggc
agcctgaaaaatacttctgctggcgatctggcagcagtagcgattaaaggcgcgttggaa
gcggcaaagttgcctggcgacaaggttgacgaagtgattgttggcaacgttgttggtgca
ggtcaaggaatgggtgttggccgccaagcggcactgtttgcggggattcctgaatctgtt
cctgcatatggcgtaaacatggtttgcggtagtggcatgaaaacggtcatggatgccgtg
tcccatatccgtagtggcgatgctgagatcgttgttgcagcgggtgttgaagtcatgtct
cagattccgtttgccgcaccaagcagcattcgtgatggcaacaaaatgggcaatctggag
ctaaaagatctgctcgtagcggacggtttaaccgatgtttacaaccaatatcacatgggt
gtgacggcagaaaacgtagcaaaacaaatcggcttaactcgccagcagcaagacgaatac
gcgctgtctagccaacagaaagcggtagccgctatcgaagctggcaaatttcaagacgaa
attgtgccagtggaagtaaagcaacgccgtgaaaccgtgatgtttgatacggatgaatac
ccaaaagcgaacgcgacaatggaagccttaagcaagctacgtcctgcttttgaccgcgaa
ggcactgtgactgcgggtaatgcatcaggcattaacgatggagcgagtgcgattatcgtg
gcgtctgaaagcgcagttaaagcgcatggattaacgccgcttgctgagatcgtaagctat
gcgcaatcgggtcttgatccgaagatcatgggcctaggtcctgttgagtcggtcaataaa
gcactcgaaaaagcagaactcacagtaaatgatatcgacgtttacgagttaaacgaagca
tttgcagcgcaagcacttggcgtgattcatcagttggcggaaacaaaccaagttccagtt
aacgcgattcaagataaagcgaactttaacggtggtgctatcgcgctaggacacccgctt
ggtgcatctggaaaccgaatcttagtcacgctggttcacgagcttcataagcaaaatggt
caatatggcgttgcttcactttgtgtgggcggcggcatgggcacggctgtggttgtaaag
acagttaagtaa

DBGET integrated database retrieval system