KEGG   Vibrio alginolyticus: N646_3995
Entry
N646_3995         CDS       T02840                                 

Definition
(GenBank) hypothetical protein
  KO
K11894  type VI secretion system protein ImpI
Organism
vag  Vibrio alginolyticus
Brite
KEGG Orthology (KO) [BR:vag00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vag02044]
    N646_3995
Secretion system [BR:vag02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   N646_3995
SSDB
Motif
Pfam: FHA NPBW PriC
Other DBs
NCBI-ProteinID: AGV19804
UniProt: A0A2I3CPH1
Position
2:1001265..1002758
AA seq 497 aa
MYSNQLVLFISKCPEEYTGAKHIEMPESGGSIGRSPSCSVSLADHNRFISGTHCLLSVYG
DTYYISDVSTNGTMVNGNKILKNQPVAIVDGDIISLGQYEIGVSLEHVTSTLDIAADIAP
ERVSSDPLVSLGDAVVEEEEKVGALEDLFMETKQDDIDCHDPVAHLNFSMQRDDDYLIRD
NERTDSEQPRTVESTRQVVDDSFSIYSEFDQPSLIPEDWMAAETKSNASVNDALAPESGK
AHRADIASAEVMQPGTVAPDSTIQRQHRTHNVTEMVVEQANTGSKWEEMTQSFTPSPNTN
QQLQIPTAEHAINSTTKAQVDTDAAVCSQDIAQAFFDGLGIRNPELMTNEAQLFKQMGTC
LRLCIDNLQKELHEVESLKDEQSASEANSNIAELMLTLNSQQLLAPNELVEQMLDELNDH
QVMFNKALNELILEQSETNDPVAFANRVASQSLFSTKSKLWAEYLDFYTNNRRLLNETSL
KGLIKKNYNKVIKGNHA
NT seq 1494 nt   +upstreamnt  +downstreamnt
atgtactcaaatcagctagttttatttatctcaaagtgtccagaggaatacaccggtgca
aagcatattgaaatgcctgaaagtggtggttcgataggtcgttccccaagctgtagcgtg
tctttagccgatcacaaccgctttatatcgggcactcattgtttgctcagcgtgtatgga
gatacctactatataagtgacgtatcaactaacggcacaatggtaaatgggaataaaata
ctaaaaaatcaacccgttgcgatagttgatggcgacatcatttctttagggcaatatgag
attggtgtttctcttgagcacgttacctcaacactagacatcgccgctgatattgctcct
gagcgagtatctagcgatcctctggttagtctaggagatgcggttgtcgaagaggaagaa
aaagtcggtgccttagaagatttgtttatggagactaaacaggatgacattgattgtcat
gatcctgttgctcaccttaacttttcgatgcagcgagatgacgattacttaattcgtgat
aatgagcgtacagattctgaacaacctagaaccgtggaaagcacgcgtcaggtggtcgat
gacagtttcagcatatattccgaattcgatcagccaagcctaatccctgaagactggatg
gctgcggaaaccaagagtaacgcatcagtcaatgatgcattagcgccagaaagcggtaag
gcacatagagccgatattgcctcagctgaggtgatgcaacctggcacggtagccccagat
agcacgattcaaagacaacatcgtacgcataatgttactgagatggtcgtagaacaggct
aacacagggtcaaaatgggaagagatgacccaatcttttacgccttctcctaacactaat
cagcaacttcaaatacctacggcagagcacgcgataaacagtacgacgaaagcacaagtc
gatactgatgcggccgtttgctctcaagatatagcgcaagcgttttttgatggcttgggt
attcgaaacccagagttgatgacaaacgaggcgcagttattcaagcaaatgggcacttgc
ttgcgtttatgtattgataacctacagaaagagttgcacgaagtggaatcgttaaaagat
gagcagagtgcgagtgaggctaactcgaacattgcagagctaatgcttactttgaatagt
cagcaattactggctccaaatgaactggttgaacaaatgctcgatgagctgaacgaccac
caagttatgtttaacaaagcactgaatgagctcattttagaacagtcagaaacgaacgat
cccgtagcatttgctaacagggtcgctagccagtctttgttctcaactaagtcaaagctg
tgggccgaatacctagatttctacactaataatcgtcgcctgcttaatgaaacatcctta
aaagggctgattaagaaaaactataacaaagtgattaagggaaaccatgcgtag

DBGET integrated database retrieval system