KEGG   Vibrio alginolyticus: N646_4138Help
Entry
N646_4138         CDS       T02840                                 

Definition
(GenBank) putative delta-9 fatty acid desaturase
  KO
K00507  stearoyl-CoA desaturase (Delta-9 desaturase) [EC:1.14.19.1]
Organism
vag  Vibrio alginolyticus
Pathway
vag01040  Biosynthesis of unsaturated fatty acids
vag01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:vag00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    N646_4138
Enzymes [BR:vag01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     N646_4138
Lipid biosynthesis proteins [BR:vag01004]
 Desaturase
  First
   N646_4138
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FA_desaturase
Motif
Other DBs
NCBI-ProteinID: AGV19947
UniProt: A0A2I3CQA6
Position
2:complement(1167630..1168754)
Genome map
AA seq 374 aa AA seqDB search
MTQNKPPVIWLNTLIFSASFVLTFIVMPWYAYHFGLGWEHLIWGVIAFSFTNLSITAGYH
RLWSHKTYEAHPILRAIFAIGGAFSLQNSALHWSSDHRVHHKHVDNNDKDPYSAKRGFWY
SHIGWMLRDYNKSKENEYTNCRDLKRDKIVMWQHKYYVPLALLTNIGFPVMLGLIYGDIW
GMLLVVGAARLFMSHHTTFFINSLAHIWGKQTFTDKNTARDNGVLAFFTFGEGYHNFHHI
FENDYRNGVYWWHYDPTKWLIKSCSWLGLTSKLRTTPTFRIEKARASQLLKKAREKLESK
PNTQTILDQLQHEFDTLVHHMQEYYEMRKEVLGAKTASVVKKYECSVTKMKYQQIKAEFE
RQQRSWNLMVRRYA
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
gtgactcaaaacaaaccacctgttatctggttgaatacattaatattttctgccagtttt
gttctaacttttattgtaatgccttggtatgcatatcattttggactgggttgggaacat
ctaatttggggagtgattgcatttagttttactaacctttctattacagcaggctatcat
cgtctctggagccacaaaacatacgaagctcatcctattttgcgcgccatttttgcgatt
ggaggagcattttctttgcaaaatagtgcattacattggtcttctgatcatcgtgtgcat
cacaaacatgtcgacaataacgataaagatccgtactcagccaagcggggtttttggtat
tctcacattgggtggatgttacgtgattacaataaatcaaaggaaaacgaatatacaaac
tgccgtgacctaaagcgcgacaaaatcgtcatgtggcagcataagtattatgttccactt
gccctactgactaatattggtttcccagtcatgctcggactgatctacggtgatatctgg
gggatgttattggtcgttggtgcggctcgactctttatgagtcaccatacgacttttttc
attaactccctcgcacatatttggggtaagcaaactttcacagacaaaaacactgctcgc
gataatggtgtactcgcctttttcacatttggagagggttaccataatttccatcatatt
ttcgagaatgactatcgcaatggcgtgtattggtggcattacgacccaacgaagtggttg
ataaagtcatgttcttggctaggactcacatctaagttgcgcacaacgcctacatttaga
attgaaaaagcccgtgcgagtcaacttttgaagaaagcaagagaaaagctagaatcgaaa
ccgaacacgcaaacaatcctcgatcagctacagcacgagtttgatactttagttcatcac
atgcaggaatactacgagatgcgcaaagaagtactcggtgccaaaactgccagtgtggta
aaaaaatacgaatgttctgtaacgaaaatgaagtaccagcaaattaaagcagagttcgaa
cggcagcagcgtagttggaaccttatggttcgtcgatacgcatag

DBGET integrated database retrieval system