KEGG   Verticillium alfalfae: VDBG_01122Help
Entry
VDBG_01122        CDS       T02227                                 

Definition
(RefSeq) cytosolic phospholipase A2 zeta
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
val  Verticillium alfalfae
Pathway
val00564  Glycerophospholipid metabolism
val00565  Ether lipid metabolism
val00590  Arachidonic acid metabolism
val00591  Linoleic acid metabolism
val00592  alpha-Linolenic acid metabolism
val01100  Metabolic pathways
val01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:val00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    VDBG_01122
   00565 Ether lipid metabolism
    VDBG_01122
   00590 Arachidonic acid metabolism
    VDBG_01122
   00591 Linoleic acid metabolism
    VDBG_01122
   00592 alpha-Linolenic acid metabolism
    VDBG_01122
Enzymes [BR:val01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     VDBG_01122
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B
Motif
Other DBs
NCBI-GeneID: 9531022
NCBI-ProteinID: XP_003009439
UniProt: C9S5A5
AA seq 742 aa AA seqDB search
MRSIVTYIRSSVGHARWFHSRRKGFDALTTHRLASKQFRTGFFTTTPQDEAKKKTRGIPT
VPAVIIAGGLFVWALYPSEEFDQISEAQTYRRERQLQRKRDKEKLERDEEQERQDRQAAK
NASSAAGPSKFPGFVRKLQRELSLAPGSLADEIWRDAHDPFINPEIRHEATVRISTDLCD
DEKEFLARRKMITRVALANRSRWTLRLRHLHFWCFRLLLASDPLLLLRRRPQLPRILEHL
KSRAAIHIAYPPVAFQALVSAPTSKYLLSGLVEKLRGDPQASFGLVDIYGLLLAARFLVP
KGELEVCDSDFKLSNQRQYIKYGQNPMPIYTAVRHEIPGIDDNEPVDSVEAAKEKAAREA
WFQWFEITPYEFFCEEFSAGIPTWALGRKFNNGVDVPPEEGFHLPEVRVPFLMGVFGSAF
CATLSHYYREVRPLVQSLSGFMNLDKIISGRYNNDLEKVHPIDPGTVANFAYGMHGRLPD
TTPPSIYDNEYIQLMDAGMSNNLPLYPLMRPGRGVEVLIAFDASADTKTDNWLAVADGYA
RQRKIKGWPVGIGWPKAGEAPEELTKELENAEASDLKDADRRLNEAQIAQKKTLGKNTTD
DLGYCTVWVGTSQERSTSPPPPSRALDDSTHWHISEPDAGIAVVYLPLLGNPEAVPGVSP
GESDFLSTWNFVYTPEQIDQVVALARANYAQGQRQIRETVRAVYLRKKKLRETKEKERKS
ERYRGLVRRGMGTRLGEGDQFS
NT seq 2229 nt NT seq  +upstreamnt  +downstreamnt
atgaggtcgatcgttacctacatacgctcctcagtgggccatgcgagatggtttcattct
cggcgaaaaggctttgatgcccttacaacacaccgattggcgagcaagcaattccgcact
gggttcttcacaaccaccccgcaagacgaggctaagaagaagacccgaggcatccctact
gtccccgctgttataatcgctggcggactgttcgtttgggctctttatccttcagaagaa
ttcgaccaaatatcagaggctcagacttaccgccgcgagcgacagttgcagcgaaaacgc
gacaaggagaagctggaaagagacgaggagcaggagcgccaagaccggcaagcagcgaaa
aacgcttcatcggccgctggtccaagcaaattcccgggtttcgtccgcaagctgcagcgc
gagttgtccttggcgcctgggtctcttgctgatgagatatggcgtgacgcccacgatccc
ttcatcaaccccgaaatccgccatgaggcgactgtccgcatctcgactgatctctgcgac
gacgagaaggaatttctcgctcgtcgcaagatgatcacacgagttgccctggccaaccga
tcaagatggactcttcgactgcgtcacctacacttctggtgtttccggctcctgctggct
tcagaccctctacttctcctccgtcggcggccgcagcttccccgcatcctggagcatctc
aagtctcgtgccgccattcacatcgcctacccacccgttgccttccaggctcttgtctct
gctccaactagcaaataccttttgagcggcttggtggagaagctgcgcggcgaccctcaa
gccagttttggccttgtcgatatttacggtctgcttctggccgctcgatttctcgttcct
aagggcgaactcgaggtctgcgacagcgacttcaagttgagcaaccagcgccagtatatc
aaatatggacagaatcccatgccaatttacacggcagttcgccacgaaatccccggtatc
gatgacaacgagcccgttgatagcgttgaggccgccaaggagaaggccgctcgagaggca
tggtttcagtggtttgagatcacgccgtacgagttcttctgcgaagaattctccgcggga
ataccaacttgggccctcggtcgtaaattcaacaacggtgttgatgtacctcctgaagag
ggcttccatctgccagaggttcgcgtgccgttcctcatgggcgtcttcggctccgctttc
tgcgcaacactcagccactactaccgcgaagtccgaccccttgtccagtctctttcgggt
ttcatgaacctggacaagatcatctctggtcgctacaacaacgatctcgagaaggttcac
cccattgacccagggactgtcgccaactttgcctacggcatgcacggccggctccctgac
accactccgccgagcatctatgacaatgagtacattcaactcatggatgctggcatgagc
aacaatttgcccctctaccctctcatgcgccctggacgtggtgtcgaggttctcatcgcg
tttgatgcctccgcggatacgaagacggataattggcttgccgtcgcagatggctatgct
cgtcaacgcaaaatcaaaggctggcccgtcggcattggctggcccaaggctggcgaggcg
cccgaagaacttacaaaagagctcgaaaatgccgaggcttccgatctgaaggatgccgac
agaaggctcaatgaagcgcagatcgcacagaagaaaacccttggcaagaacaccactgac
gatctggggtactgcaccgtttgggtgggaacgtcacaggagcggtccaccagcccgcct
ccgccatccagagctctcgatgactcgacgcactggcacatctctgagcccgatgcgggg
attgcggttgtgtacttgccactcctcgggaatccagaagccgtgccaggtgtcagtcct
ggcgagtcggacttcttgtcgacctggaactttgtctacacgcctgagcagattgaccag
gtcgttgccctagcccgcgccaactacgcacaaggccaaaggcaaattcgcgagacggtg
agagcggtctatttgcggaagaagaaactcagagagaccaaggagaaggagcgaaagtca
gagcgatatcggggcctcgtcagacggggaatggggacgagattgggcgagggcgatcag
ttcagttga

DBGET integrated database retrieval system