KEGG   Verticillium alfalfae: VDBG_01173Help
Entry
VDBG_01173        CDS       T02227                                 

Definition
(RefSeq) mannitol-1-phosphate 5-dehydrogenase
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
val  Verticillium alfalfae
Pathway
val00051  Fructose and mannose metabolism
val01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:val00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    VDBG_01173
Enzymes [BR:val01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     VDBG_01173
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh UDPG_MGDP_dh_N ApbA
Motif
Other DBs
NCBI-GeneID: 9531074
NCBI-ProteinID: XP_003009490
UniProt: C9S5K0
AA seq 396 aa AA seqDB search
MAPATTKKAVHFGAGNIGRGFVACFLHNSGYEVVFADVADSLIDSINATPSYKVIEVGTE
GTDENTITNYRAINSKTHEADLIEEIATADVVTCSVGPNILRFIAPVIAKGIDKRSNDLA
PIAVIACENAIGATDTLAGHIKDPKNTPEHRLEDHHERARYANSAIDRIVPAQDPNAGLD
VKLEKFFEWVVESGPFAETGHPTIDGINWVDNLGPYIERKLYTVNTGHATAAYHGYNRSK
RTVYDALQDKAILAEVRQALKETTELMVTKHGINLEEQQAYAEKIIKRIGNPHLEDAVER
VGRAPMRKLSRKERFVGPAAELAENDLGCKALLRAAEMAFRFQDVEEDEESKELAKIMAE
NGPEDVVQKVCGIQASEKIHPMLVEVVRRVQADSEE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggcgcccgctactacgaagaaggccgtccacttcggtgctggcaacattggccgtggc
ttcgtcgcatgctttctccacaactctggttacgaggttgtcttcgcggatgttgccgat
tctctgatcgactcgatcaacgccaccccctcatacaaggtcattgaggttggcactgag
ggcaccgacgagaacaccatcacaaattaccgtgccatcaactccaaaacgcacgaggct
gatctcattgaagagattgccactgccgacgtcgtcacttgctctgtcggacccaacatt
ctgcgtttcattgcccccgttatcgccaagggtattgacaagcgctccaacgacctcgcc
cccatcgcggtcattgcctgcgagaacgccattggcgccactgacaccctcgccggtcac
atcaaggaccccaagaacacgcctgagcaccgtcttgaggaccaccacgagcgtgcccgc
tatgccaactcggctattgaccgcattgtgcctgcacaagaccccaacgccggtctggac
gtgaagctggagaagttctttgagtgggtcgttgagagcggtcccttcgctgagactggc
caccccaccattgacggtatcaactgggtcgacaaccttggcccttacatcgagcgcaag
ctctacacggtcaacactggccacgccacagccgcctaccacggatacaaccgcagtaag
cgcaccgtctatgatgctctgcaagacaaggcaattttggcggaggttcgccaagctcta
aaggagaccacggagctcatggtcaccaagcacggcatcaaccttgaggagcagcaggcg
tacgctgagaagatcatcaagcgcatcggcaacccccatctggaagatgccgtcgagcgc
gtcggccgtgcccccatgcgcaagctgagccgcaaggagcgctttgtcggccccgctgcc
gagctcgctgagaacgaccttggctgcaaggctcttctgcgcgctgccgagatggcgttc
cgcttccaggacgtcgaggaggatgaggagagcaaggaactcgccaagatcatggctgag
aatggtcccgaggatgtcgttcagaaggtctgtggtatccaggcttctgaaaagatccat
cccatgcttgttgaggtcgtccgcagggtccaggccgactctgaggaatga

DBGET integrated database retrieval system