KEGG   Verticillium alfalfae: VDBG_02545Help
Entry
VDBG_02545        CDS       T02227                                 

Definition
(RefSeq) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
val  Verticillium alfalfae
Pathway
val00450  Selenocompound metabolism
val00970  Aminoacyl-tRNA biosynthesis
val01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:val00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    VDBG_02545
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    VDBG_02545
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:val01007]
    VDBG_02545
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:val03016]
    VDBG_02545
Enzymes [BR:val01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     VDBG_02545
Amino acid related enzymes [BR:val01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   VDBG_02545
Transfer RNA biogenesis [BR:val03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    VDBG_02545
 Prokaryotic type
   Other AARSs
    VDBG_02545
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 Anticodon_1
Motif
Other DBs
NCBI-GeneID: 9535457
NCBI-ProteinID: XP_003006406
UniProt: C9SDL5
AA seq 679 aa AA seqDB search
MATAEPILPVKGKNNVLVTSALPYVNNTPHLGNVIGSVLSADVFARFSRARGNPTIFICG
SDEYGTATETKALEEGVDPETLCRKYHAVHKGIYEWFNLSFDIFGRTPTEQQTEIVQDIF
RKLWQNGYIEERETTQPFCPVHHSFLADRFVEGECSLCGYNDARGDQCDKCGNLLDPLEP
EPEAGNAKPDDDIAAKATGWLINPRCKLDGAKPDKKQTKHLFLRLDALKEPLIDWFKKAS
TEGAWSTSAQTITQAWIDKGLKPRGITRDLKWGVPVPTDVTGEDYAAKVFYVWFDACIGY
VSITKNYTDGADLAGKKWEQWWKNPDEVKLYQFLGKDNVQFHSTVFPASQLGTNENWTKV
HKISATEYLNYEGGKFSKSRGVGVFGNQVQETGVPSDVWRYYLLSRRPETSDSEFMWQEL
VDGNNNELLKNLGNFCQRVIKFAQAKLDTTVPDYTKFGLNDYLKNHVKEVNVNLKEYIAN
MEGTKFRDGLRSILSISALGNKLLQDNKLDNKLLTEEPDRCAAIIGLALNQIALIASILN
PYMPVTSKAIFEQLGVEPTPTIPDEWVTGAIKPGQKLGEAKHLFSQIPASKIEEWREAFG
GEEVRKQKEEAAAKAAAKKAAKEREKEKKRLKKEAAKAAAASGAEAALAGVESGEKKSEA
DPAIEAVTEAIAKADVHTS
NT seq 2040 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccgccgagcctattctccccgtcaagggtaagaacaacgtcttggtcacttcc
gcccttccctatgtcaacaacacgccccatctcggcaacgtcatcggcagtgtcctctcc
gccgatgtttttgcgcgcttctcccgcgctcgcggcaacccgactatcttcatctgcggc
tccgacgagtacggtactgccaccgagaccaaggcccttgaggagggcgtcgacccagag
accctgtgccgaaagtaccatgccgtccataagggcatctacgagtggttcaatctatcc
tttgacattttcggccgcactccgaccgagcagcagaccgagattgtccaggatatcttc
cgcaagctgtggcaaaacggctacatcgaggagcgcgagacgacccagcccttctgccca
gttcaccacagcttcctggcagatcgctttgttgagggtgaatgctccctctgcggctac
aacgacgcccgtggcgaccagtgtgacaagtgcggcaaccttctcgatcccctcgaaccc
gagcccgaggccggcaacgccaagcccgacgatgacatcgctgcgaaggccaccgggtgg
ttgatcaaccctcgatgcaagctggacggcgccaagcccgacaagaagcagacgaagcac
cttttccttcgtctcgacgcgcttaaggagccgctcatcgattggttcaagaaggcgagc
actgagggcgcgtggagcaccagcgcccagaccatcactcaggcgtggatcgacaaggga
ctgaagccgcgcggtatcacgagagatcttaagtggggtgttcccgttcctacagatgtt
actggcgaggactatgccgccaaggttttctatgtttggttcgatgcctgcattggctac
gtctcgatcaccaagaactataccgatggggccgacctcgccggcaagaagtgggagcag
tggtggaagaacccggatgaggtcaagctgtaccaattcctcggcaaagacaacgtccag
ttccacagcaccgtcttccccgcgtcgcagctcggcaccaacgaaaactggaccaaggtt
cacaagatctctgccactgagtacctcaactatgagggtggcaaattcagcaaatcgcgt
ggtgtcggcgtcttcggcaaccaggtccaggagactggcgttccttcggatgtctggaga
tattacctgctctcgcgccgtccagagacgtcagactcggaattcatgtggcaggagctg
gtggatggcaacaacaacgaattgctgaagaacctcggaaacttttgccagcgagtcatc
aagtttgcgcaggccaagcttgacactaccgttcccgattacaccaagttcggtctcaac
gactacctaaagaaccacgtcaaggaggtcaacgtgaacctcaaggagtatattgccaac
atggagggcaccaagtttcgcgatggtctcaggagcattctgtccatctcggccctcggc
aacaagttgcttcaggacaacaagctcgacaacaagcttctcactgaggagcctgatcgt
tgcgcggccattatcggcctggcactcaaccagattgcgctcatcgccagcattctgaac
ccatacatgcccgtgacgtccaaggccatctttgagcagctaggcgtggagcctacgccg
acgatcccggacgagtgggtcacgggcgcgatcaagcccggccagaaattgggcgaggcg
aagcatttgttctcgcaaatccccgcgagcaagattgaggagtggcgcgaggcatttggc
ggcgaagaggtgcgcaagcaaaaggaggaggcggccgccaaggcagctgctaagaaggcg
gccaaggagcgggagaaggagaagaagcgccttaagaaggaggctgctaaggccgccgct
gcttctggcgccgaggctgcgctagcgggggtggagtccggggagaagaagagcgaggca
gatcctgcgattgaggcggtcactgaggcgattgccaaggctgacgtgcacacctcgtaa

DBGET integrated database retrieval system