KEGG   Verticillium alfalfae: VDBG_02880Help
Entry
VDBG_02880        CDS       T02227                                 

Definition
(RefSeq) invertase
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
val  Verticillium alfalfae
Pathway
val00052  Galactose metabolism
val00500  Starch and sucrose metabolism
val01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:val00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    VDBG_02880
   00500 Starch and sucrose metabolism
    VDBG_02880
Enzymes [BR:val01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     VDBG_02880
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C DUF4975
Motif
Other DBs
NCBI-GeneID: 9532883
NCBI-ProteinID: XP_003006741
UniProt: C9SCF6
AA seq 680 aa AA seqDB search
MAALKITSAVTAITSLAALATPAFAQDLSAEYPTLTADILEGLGNSSLFTRWRPRSHYMS
PHSWMNDPCGPLYDPTTETYHLHYQYHPNHVNWGNISWGHAVSKDLFHWTDVRDWANDSA
VSLASGKYPSGPLSQFTGTSQPVNLQGEQDGTILTFATGIQFLPTNWKIPYTNGTEVQAL
YTSSDGGLTWEEVGTVLDGPPDGWNVTGWRDPSFFPSTLLDELLSVDEPHYYMVLGSGLK
GGDVPFPLPGAERPGFLGPRIPLYAAPASNLEAWEFLGALWEPAANSSLGIPDVTGSYGY
NFEVSSLFELDTPSGGKAWFFGAGAEGGNTTTHWREQWALWNRGEVSARENGSVAFAPNS
GGALDWGMAYAQATWNDTKENRRVMWGWAIEEVNDAYVFNTTKQLGYNGVMTLPTELFVK
ETKNVLNCDVQPDGNLCVKQKDGRFTAETLGLRPLPDVLDLMRNGSEAHDFEVGELHSTH
HRAVTHAGSSYELKATLSNFNGTAGILVAQSPDHAEYTVIYLDPETKQIGINRDHSSLLP
HFGNRTFVGHFEAYEFRETGSNKTTTEDVNFHVVVDGSLLEVWINERFAMTARMYPSRSD
STGISFFAGSWENKEAGGGCKHSAEEDENESADVVQASWSNVQVWKGLSNAWPDRPSDSS
VQLVWDSPEDTNNYTWWAGY
NT seq 2043 nt NT seq  +upstreamnt  +downstreamnt
atggcggcactcaagattacttcggccgtgacggccatcacatccctcgcagctttggcg
actcctgccttcgcacaagacttatcggccgagtatccaacgctgacggccgacatcctc
gagggtctgggcaacagctccctattcacacgctggcgccctcgttcgcattacatgtca
cctcactcatggatgaatgatccgtgcggtcctctctacgacccgaccacagagacttac
cacctacactaccagtatcaccctaaccacgtcaactggggcaacatctcctggggacac
gccgtctccaaggaccttttccactggaccgatgtccgcgactgggccaatgactcggcc
gtgagcctggcctcgggcaagtacccctctggccctctgtcacagttcaccggcacctct
cagccggtcaacttgcagggtgagcaggatggaactattctcacctttgctactggcatc
cagttcctcccgaccaactggaagattccctacaccaacggcacggaggtccaggccctt
tacacgtcctccgacggcggcctcacctgggaggaggttggcactgtgcttgatggcccg
ccggatggctggaacgtcaccggctggcgtgatcccagcttcttcccgtcaaccctcctc
gacgagctgctctcggttgacgagccgcattattacatggttcttggctctggtctcaaa
ggtggtgatgttcccttcccgcttcccggtgccgagcgcccaggattcctcggacctcgt
atcccactgtatgcggcgccagcgtcgaacctcgaggcatgggagttcctcggtgccctt
tgggagccggccgccaatagctcactcggtatccctgatgtcacgggctcctacggctac
aacttcgaggtcagcagcctgttcgagctcgacacgccttcgggtggcaaggcgtggttc
ttcggagcgggagccgagggcggcaacacgacgacgcactggcgcgagcagtgggcgttg
tggaaccgcggcgaggtgtcggcgcgggagaatggttcagtcgcatttgcgcccaactcg
ggcggcgcgctggactggggcatggcctacgcacaggcaacatggaacgacaccaaggag
aaccgtcgcgtcatgtggggttgggccatcgaagaggtcaacgacgcgtacgtcttcaac
acgacgaagcagctgggctacaacggcgtcatgacgctgccgactgagctgtttgtcaag
gagaccaagaacgtcctgaactgcgatgtccagcccgacggcaacctctgtgtcaagcaa
aaggatggcaggttcacagcggagacgctcggcctccgacctcttcccgacgtcctcgac
ttgatgcgcaacggcagcgaggcccacgactttgaggtaggcgagcttcacagcacccac
caccgcgcggtgacccatgccggatcatcgtatgagcttaaggcgacgctcagcaacttc
aatggcacggcaggtattctggttgcccagagcccggatcatgccgagtacaccgtcatt
tacctcgaccccgagaccaagcagattggcatcaaccgcgaccatagcagtcttttgcct
cacttcgggaaccgcacatttgtaggccactttgaggcgtatgagttcagggagactggt
agcaacaaaacgacgaccgaagacgtcaacttccacgttgttgttgatggctcgctcctc
gaggtctggatcaacgagcggtttgccatgacggcacgcatgtacccctcgcgtagcgac
agtactggcatcagcttcttcgcgggaagctgggagaacaaggaggctggtggtggatgc
aagcactcggcagaggaggatgaaaatgagagcgcagatgttgtacaggcttcgtggagc
aacgttcaggtatggaagggactttcgaatgcctggcccgacaggccgtccgattcgagc
gtgcagcttgtgtgggactcccctgaggacaccaacaactacacatggtgggcggggtac
tag

DBGET integrated database retrieval system