KEGG   Verticillium alfalfae: VDBG_03244Help
Entry
VDBG_03244        CDS       T02227                                 

Definition
(RefSeq) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
val  Verticillium alfalfae
Pathway
val00220  Arginine biosynthesis
val00330  Arginine and proline metabolism
val01100  Metabolic pathways
val01110  Biosynthesis of secondary metabolites
val01130  Biosynthesis of antibiotics
val01230  Biosynthesis of amino acids
Module
val_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:val00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    VDBG_03244
   00330 Arginine and proline metabolism
    VDBG_03244
Enzymes [BR:val01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     VDBG_03244
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-GeneID: 9533267
NCBI-ProteinID: XP_003007105
UniProt: C9SDI3
AA seq 296 aa AA seqDB search
MSLCTSMVKSKFLDKPEDIGVVVAGFSGGQRKAGVDHGPQALIDAGLLTSLRAELGYTLH
GDDKVHSYEDIIPADDAPVRNMKNPRIAVGTIGGSARATRERLGREIAVIWVDAHADINT
PETSDSGNITACPWRLSRASPRRRKRDCFGWLQDENMLSLKKLVYIGLRDVDAGEKRILR
ENGVKAFSMHDVDRHGIGKVMDMALAHIGTDTPIHLSFDVDALDPQWAPSTGTPVRGGLT
LREGDYICECVHETGSLIAVDLVEVNPALADTEIGAAETIRAGCSLVRCALGESLL
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctgtgcacctccatggtcaagtccaagttcctcgacaagcctgaggacattggc
gttgtcgttgctggcttctctggtggtcagcgcaaggcaggtgtcgaccacggcccccag
gctctcatcgacgccggtctcctgacctcgctgcgcgccgagctcggctacaccctccac
ggcgacgacaaggtccactcgtacgaggacatcatccccgccgacgatgcgcccgtccgc
aacatgaagaacccgcgcatcgccgtcggcaccattggcggctcggcgcgcgccacgcgc
gagcgtctcggccgcgagatcgccgtcatctgggtcgacgcccacgccgacatcaacacg
cccgagacgtcggacagcggcaacatcacggcatgcccgtggcgtttgtcacgggcctcg
ccaaggaggcggaagcgcgactgcttcggctggctccaggacgagaacatgctgagcctc
aagaagctcgtgtacattgggctgcgcgacgtcgacgccggcgagaagaggatcctgcgc
gagaacggcgtcaaggcgttcagcatgcacgacgtcgaccgccacggcatcggcaaggtc
atggacatggcgctcgcgcacattggcaccgacacgcccatccacctgtcgttcgacgtc
gacgcgctcgacccccagtgggcgcccagcaccggcacgcccgtgcgcggcggcctgacg
ctgcgcgagggggactacatctgcgagtgcgtgcacgagacgggcagcctcatcgccgtc
gacctcgtcgaggtcaacccggcgctcgccgacacggagattggcgccgccgagaccatc
agggccggctgctccctcgtgcgttgcgccctgggcgagtcgctgctgtga

DBGET integrated database retrieval system