KEGG   Verticillium alfalfae: VDBG_03563Help
Entry
VDBG_03563        CDS       T02227                                 

Definition
(RefSeq) nitrate reductase
  KO
K00326  cytochrome-b5 reductase [EC:1.6.2.2]
Organism
val  Verticillium alfalfae
Pathway
val00520  Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:val00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    VDBG_03563
Enzymes [BR:val01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     VDBG_03563
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NAD_binding_1 FAD_binding_6 Cyt-b5 NAD_binding_6 FAD_binding_9
Motif
Other DBs
NCBI-GeneID: 9532295
NCBI-ProteinID: XP_003005610
UniProt: C9SGB4
AA seq 458 aa AA seqDB search
MADVQEFTAKEVAAHNTRDDCWMIIQGQVYDVTKYIHDHPGGADVLIDAAGQDATVEFDN
AGHSEDAFEIMAEYHLGKYKGMPTRNAPKPVILKPQAALPTASSARSLASKTAGALAILS
LGAAVAYQASSRLHVPSALLLPKLRLRRPTELGFIEGFAVATAVFAVAGAVVSKKLAALL
HFEEAGFMRYAPHKKIPRIAKPNPLLQRGWLDSTNYAPLPLVAKELLAPSVYRLAFALPT
SKTALGLPIGQHVAIKAEIDGKVVSRSYTPTSNNADLGTLELVVRCYPDGALTGRYLAHL
QVGDEVLFRGPKGAMRYRRGMCRRIGMVAGGTGITPMFQLVRAVCEDDSDTTEISLVYAN
RSEGDILLRRELEAYARRYPANLKLHYLVDKAEDGWQFGTGFVTKDVIRERLPAPAPDAK
ILLCGPPGMVTAAKTALVELGFEKPGASAKMTDQVFCF
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atggcagatgtgcaagagtttacggccaaagaggtcgctgctcataacacccgcgatgat
tgttggatgattatccaaggtcaagtctacgatgtcaccaagtacatccacgaccatcct
ggaggcgcagatgtgctcattgacgccgctggtcaggatgctacggtagagttcgataac
gcaggccactctgaagatgcctttgagatcatggctgaataccaccttggcaaatacaag
ggcatgcccacacgaaatgcacccaagcccgtcatcctcaagccccaggctgccctgccg
acggccagctcagcccgaagcctggcgtccaagaccgccggcgctcttgccatcctgtca
ctgggagcagctgttgcgtaccaggcctcctcccgccttcatgtcccgagcgcgctatta
cttcctaagctccgtctccgccgtccaacagaattgggcttcatcgagggctttgccgtg
gccactgccgttttcgccgttgctggcgctgtggtcagcaagaagctcgctgcgctcctt
cacttcgaggaggccggtttcatgcgttatgcgccgcacaagaagattcccagaatcgcc
aaaccaaaccccctcctccagcgcggctggctcgactcaaccaactacgcgcccctgcca
ctcgtagccaaggagcttctcgcaccctccgtctaccgcctcgccttcgccctgccgacc
agcaagacggcccttggtctgcccattggccagcacgtcgccatcaaggccgagatcgat
ggcaaggtcgtctcgcggtcctacacacccacatcaaacaatgccgaccttggcaccctc
gagctcgttgtgcgatgctaccccgacggcgcgctgacgggccgctacctcgcccacctg
caggtcggcgacgaggtcctcttccgcgggcccaagggtgccatgcgctaccgccgcggc
atgtgccgcaggatcggcatggtcgccggcggcacaggcatcacgcccatgttccagctc
gtgcgcgccgtgtgcgaggacgacagcgacacgaccgagatcagcctagtctatgcgaac
cgctccgagggcgatattctgctgcgtcgcgagcttgaggcctatgcgcgccgctacccg
gccaacctgaagctgcactacctcgttgacaaggccgaggacggctggcagtttggcacc
ggctttgtgaccaaggacgtcatacgggagaggctgccggcgccggcgccggatgccaag
attttgctgtgtgggccccccggcatggtgaccgctgcaaagacggcacttgtcgagctc
ggattcgagaagccgggggcgtcggcgaagatgaccgatcaggtgttttgcttctag

DBGET integrated database retrieval system