KEGG   Verticillium alfalfae: VDBG_03874Help
Entry
VDBG_03874        CDS       T02227                                 

Definition
(RefSeq) heat shock protein SSB1
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
val  Verticillium alfalfae
Pathway
val03040  Spliceosome
val04141  Protein processing in endoplasmic reticulum
val04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:val00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    VDBG_03874
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    VDBG_03874
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    VDBG_03874
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:val01009]
    VDBG_03874
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:val03041]
    VDBG_03874
   03009 Ribosome biogenesis [BR:val03009]
    VDBG_03874
   03110 Chaperones and folding catalysts [BR:val03110]
    VDBG_03874
   04131 Membrane trafficking [BR:val04131]
    VDBG_03874
   03051 Proteasome [BR:val03051]
    VDBG_03874
   03029 Mitochondrial biogenesis [BR:val03029]
    VDBG_03874
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:val04147]
    VDBG_03874
Protein phosphatases and associated proteins [BR:val01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     VDBG_03874
Spliceosome [BR:val03041]
 Complex B
  Other components
   Prp19 complex
    VDBG_03874
 Complex C
   Prp19-CDC5 complex
    VDBG_03874
Ribosome biogenesis [BR:val03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    VDBG_03874
Chaperones and folding catalysts [BR:val03110]
 Heat shock proteins
  HSP70 / DNAK
   VDBG_03874
Membrane trafficking [BR:val04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    VDBG_03874
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    VDBG_03874
Proteasome [BR:val03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    VDBG_03874
Mitochondrial biogenesis [BR:val03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    VDBG_03874
Exosome [BR:val04147]
 Exosomal proteins
  Proteins found in most exosomes
   VDBG_03874
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C
Motif
Other DBs
NCBI-GeneID: 9536867
NCBI-ProteinID: XP_003005921
UniProt: C9SEX9
AA seq 485 aa AA seqDB search
MKEIAEVKLGKKVEKAVITVPAYFNDNQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLG
AGKSNKERNVLIYDLGGGTFDVSLLNIQGGVFTVKATSGNTHLGGQDFDTSLLEHCKKDF
QRKSKKDISNDPRALRRLRTACERAKRTLSSGAQATIEIDSLFDGEDFQMQITRARFEEL
NAKAFNGTLEPVAQVLKDANLQKSAVEEIVLVGGSTRIPRIQKLLSEFFDGKKLEKSINP
DEAVAYGAAVQAGILSGKATSAETADLLLLDVCPLSLGVAMEGNIFAPVVPRGNTVPCIK
KRTFTTVADNQQTVQFPVYQGERVNCEDNTSLGEFTLAPIPPMRAGEAVLECVFEVDVNG
ILKVTATEKTSGRSANITISNSVGKLSSHEIENMINDAEKFKSSDEAFSKKFEAKQQLES
YIGRVEEIISDPTLSLKLKRGQKDKIEQQVSEAMAKLEITDASAEDLKKQELALKRLVTK
AMSSR
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgaaggagattgctgaggtcaagctcggcaagaaggttgagaaggccgtcatcaccgtc
cccgcctacttcaacgacaaccagcgtcaggccaccaaggacgccggtgccatcgctggt
ctcaacgttctccgtatcatcaacgagcccaccgctgccgccatcgcctacggtctcggc
gctggcaagtccaacaaggagcgcaacgttctcatctacgatctcggtggtggtactttc
gatgtctccctcctgaacatccagggtggtgtcttcaccgtcaaggccacttccggtaac
acccatcttggtggccaggacttcgacaccagcctcctcgagcactgcaagaaggacttc
cagcgcaagtcgaagaaggatatctccaacgacccccgtgccctgcgtcgtctccgcact
gcttgcgagcgtgccaagcgtaccctgtccagcggtgcccaggccaccattgagatcgac
tccctcttcgacggcgaggacttccagatgcagatcactcgtgcccgtttcgaggagctc
aacgccaaggccttcaacggcaccctcgagcccgtcgctcaggtcctgaaggatgccaac
ctccagaagagcgccgttgaggagattgtcctcgtcggtggttccactcgtattccccgt
atccagaagctcctgtccgagttcttcgacggcaagaagctcgagaagagcatcaacccc
gacgaggctgtcgcctacggtgccgccgtccaggccggtatcctctccggcaaggccacc
tccgccgagactgccgacctcctgcttctcgacgtctgccccctttccctcggtgtcgcc
atggagggtaacatcttcgcccccgtcgttcctcgcggcaacactgttccgtgtatcaag
aagaggaccttcaccactgttgccgacaaccaacaaaccgtccagttccccgtctaccag
ggtgagcgtgtcaactgcgaggacaacacctcgctgggtgaattcactcttgctcccatc
ccccccatgcgcgccggtgaggccgtcctcgagtgtgtcttcgaggtcgacgtcaacggt
atcctcaaggtcaccgccaccgagaagacctccggccgtagcgccaacatcaccatctcc
aactctgtcggcaagctctcttctcacgagattgagaacatgatcaacgacgccgagaag
ttcaagtccagcgacgaggccttctccaagaagttcgaggccaagcagcagctcgagtcc
tacattggtcgcgttgaggagatcatctctgacccgacactgtccctcaagctcaagcgc
ggccagaaggacaagattgagcagcaggtcagcgaggccatggccaagcttgagatcacc
gacgcctcggctgaggacctcaagaagcaggagctcgctcttaagcgtctcgtcaccaag
gccatgtcttcacggtaa

DBGET integrated database retrieval system