KEGG   Verticillium alfalfae: VDBG_04023Help
Entry
VDBG_04023        CDS       T02227                                 

Definition
(RefSeq) tryptophan synthase
  KO
K01694  tryptophan synthase [EC:4.2.1.20]
Organism
val  Verticillium alfalfae
Pathway
val00260  Glycine, serine and threonine metabolism
val00400  Phenylalanine, tyrosine and tryptophan biosynthesis
val01100  Metabolic pathways
val01110  Biosynthesis of secondary metabolites
val01130  Biosynthesis of antibiotics
val01230  Biosynthesis of amino acids
Module
val_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:val00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    VDBG_04023
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    VDBG_04023
Enzymes [BR:val01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     VDBG_04023
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trp_syntA PALP
Motif
Other DBs
NCBI-GeneID: 9532685
NCBI-ProteinID: XP_003006070
UniProt: C9SFC8
AA seq 629 aa AA seqDB search
MDHIRKTFQRCKAENRVSRSALVTYVTAGFPTAEETPDILLAMEKGGADILELGAPFTDP
IADGPTIQTSNTIALQNGVTIESTLKMVKDARSKGLKAPVLLMGYYNPLLSYGEERLLND
CADSGVNGFIVVDLPPEEAVSFRKLCNKGQLSYVPLIAPATSDARMKILCQLADSFIYVV
SRQGVTGALGSLNANLPELISRVKKYSGDKPAAVGFGVSTREHFQSLATLSDGVVVGSQI
ITTLQKATPENRLKDLEEYCAYLGGRRPEAANETTREVGIVEAIADAKAPEPVPTGHHHG
RAGQRPERAARRHARQDSRALRRIRRTINNDPKFWEEYRSYYDYMGRPGHLHLAERLTEH
AGGANIWLKREDLNHTGSHKINNALGAGQHGVATATVCAKFGMECTVYMGAEDVRRQALN
VFRMKLLGAKVSVIGEETKRQMQEKRGKLPDAVVACVGGGSNAVGMFYPFSNDPSVRLVG
VEAGGDGVETARHSATLSGGTKGVLHGVKTYVLQDKHGQISETHSVSAGLDYPGVGPELS
SWKDSNRAQYVVATDAEAFIGFRLMSQLEGIIPALESAHGIYGALELAKTMKKDEDVVIC
LSGRGDKDVQSVADELPTLGPKIGWDLRF
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atggatcacattcgcaagacttttcagcgctgcaaggccgagaacagggtgagtcgatca
gccctcgtgacatatgtcaccgccggctttcctacggctgaggagacgcctgatattctc
ctcgctatggagaagggtggagctgatatcctcgagctcggcgcgcccttcacagaccct
atcgccgacggcccgaccattcagacctccaacacaattgctctgcaaaatggcgtcacc
atcgagtccacactgaagatggtcaaggatgcgaggagtaagggcctcaaggcgccagtt
ctgctgatgggatactacaaccctctcttgagttacggcgaggagaggctcctcaacgac
tgcgctgacagcggcgtcaatggcttcatcgttgtcgacctgccgcccgaggaggccgtc
tcgttccgcaagctttgcaacaagggacaactctcctacgttccccttatcgcgcccgcc
acatctgatgcccgcatgaagattctctgccagctcgccgactctttcatctacgtcgtt
tcccgccaaggcgttaccggtgccctcggctccctgaacgccaacctccccgaactcatc
tcccgcgtgaagaagtacagcggcgacaagcccgccgctgtcggctttggcgtcagcacc
cgcgaacacttccagagccttgctaccctctccgatggtgtcgtcgtcggcagccagatc
atcacgaccctgcagaaggccacccctgagaaccgcctcaaggacctcgaggagtactgt
gcctatctcggcggccgcaggcccgaggccgcgaacgaaacgacgcgcgaagtcggcatc
gttgaggccattgccgatgccaaggcccccgagcccgttcctaccggccaccatcacggc
cgagcaggacagcgacctgaaagggcagctcgccgccatgcacggcaagattcccgagcg
cttcggcgaattcggcggacaatcaacaacgaccccaagttctgggaggagtacaggtcc
tactacgactacatgggccgacctggccacctgcacctcgcagagcgcctgacagagcac
gctggaggtgccaacatttggttgaagcgtgaggatctcaaccacacgggctcccacaag
atcaacaatgcgctgggcgccggccagcacggtgtcgcgacggcgactgtctgcgccaag
ttcggcatggagtgcaccgtctacatgggcgccgaggacgtgcgccgccaggctctcaac
gtgttccgcatgaagctcctcggcgccaaggtttccgtcattggcgaggagacgaagcgc
cagatgcaggagaagcgcggcaagctgccggacgccgtcgtcgcctgcgtcggcggcggc
agcaacgccgtcggcatgttctaccccttttccaacgaccccagtgtccggcttgtcggt
gtggaggccggcggcgacggcgtcgagacggcgcgccacagtgccacgctctccggcggc
acgaagggtgtgctgcacggcgtcaagacgtacgtcctgcaggacaagcacggtcagatt
tccgagacgcactccgtctcggctggtctcgactacccgggtgtcggccccgaactgagc
tcctggaaagacagcaaccgcgcccagtacgttgtcgccaccgatgcggaggcctttatc
ggcttccgcctcatgagccagctcgagggtatcattcccgcgctcgagtcggcgcacggc
atctatggtgcgctcgagctcgccaagacgatgaagaaggacgaggacgtcgtcatctgc
ctcagtggacgtggtgacaaggacgtgcagagcgtggccgacgagctgccgacgttggga
cctaagattggctgggacttgcgattttag

DBGET integrated database retrieval system