KEGG   Verticillium alfalfae: VDBG_04576Help
Entry
VDBG_04576        CDS       T02227                                 

Definition
(RefSeq) mitochondrial 54S ribosomal protein YmL44
  KO
K17434  large subunit ribosomal protein L53
Organism
val  Verticillium alfalfae
Brite
KEGG Orthology (KO) [BR:val00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:val03011]
    VDBG_04576
Ribosome [BR:val03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    VDBG_04576
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MRP_L53 Ecotin KorB_C
Motif
Other DBs
NCBI-GeneID: 9530185
NCBI-ProteinID: XP_003004970
UniProt: C9SHP4
AA seq 98 aa AA seqDB search
MITKYMTEITTRFNPFTMQARPARLFLSFLPPNARQSGLTINTVLLPKTSKEAPSLFVKF
KDGKEMTLDCEKLGIKGLLEEVDRHSRGLQKQADMTDS
NT seq 297 nt NT seq  +upstreamnt  +downstreamnt
atgatcaccaaatacatgaccgagatcaccacgcggttcaatccgtttacgatgcaggcc
cgccccgcccgcctcttcctctccttcctgccacccaacgcgcgccagtccggcctcacg
atcaacacggtcctgctgcccaagacgtccaaggaggcgccctcgctgtttgtcaagttt
aaggatggcaaggagatgacgctcgactgcgagaagctggggatcaagggcctgctggaa
gaggtcgatcggcactcgagaggcctgcagaagcaggccgacatgacggattcttga

DBGET integrated database retrieval system