KEGG   Verticillium alfalfae: VDBG_05083Help
Entry
VDBG_05083        CDS       T02227                                 

Definition
(RefSeq) dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
val  Verticillium alfalfae
Pathway
val00020  Citrate cycle (TCA cycle)
val00310  Lysine degradation
val01100  Metabolic pathways
val01110  Biosynthesis of secondary metabolites
val01130  Biosynthesis of antibiotics
val01200  Carbon metabolism
Module
val_M00009  Citrate cycle (TCA cycle, Krebs cycle)
val_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:val00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    VDBG_05083
  Amino acid metabolism
   00310 Lysine degradation
    VDBG_05083
Enzymes [BR:val01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     VDBG_05083
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh
Motif
Other DBs
NCBI-GeneID: 9536689
NCBI-ProteinID: XP_003003970
UniProt: C9SJV6
AA seq 139 aa AA seqDB search
MSTSAWLLQPRRVFVTPVVAQHRVPWGMVGIEQAIADMGKKARDGKLTIEDMAGGTFTIS
NGGVFGSLMGTPIINLPQTAVLGLHAIKDRPIAVNGKVEVRPMMYLALTYDHRLLDGREA
VQFLVKIKEYIEDPRRMLL
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacatcagcgtggctgttgcaaccgagaagggtctttgtgacacccgtcgtggcg
caacacagagttccatggggcatggttggcattgaacaggcaattgccgacatgggcaag
aaggctcgtgacggcaagctcacgattgaggacatggctggtgggactttcactatcagc
aatggcggcgtttttggttccctcatgggaactcctatcattaaccttccccagactgcc
gttcttggtctccatgccattaaggatcgcccgattgctgtcaatggcaaggtcgaggtt
cgtcccatgatgtacctcgctctcacctacgaccatcgcctactcgacgggagggaggcc
gtgcagtttttggtgaagataaaggagtacattgaggatccaaggaggatgctgctgtaa

DBGET integrated database retrieval system