KEGG   Verticillium alfalfae: VDBG_05287Help
Entry
VDBG_05287        CDS       T02227                                 

Definition
(RefSeq) kinase
  KO
K00898  pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
val  Verticillium alfalfae
Brite
Enzymes [BR:val01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.2  [pyruvate dehydrogenase (acetyl-transferring)] kinase
     VDBG_05287
Protein kinases [BR:val01001]
 Serine/threonine kinases: Other
  PDHK family [OT]
   VDBG_05287
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BCDHK_Adom3 HATPase_c HATPase_c_3
Motif
Other DBs
NCBI-GeneID: 9531153
NCBI-ProteinID: XP_003004174
UniProt: C9SKG0
AA seq 467 aa AA seqDB search
MSWKKTEGLMNTIKHYASFPATGVSLRQMVQFGEKPSTGTLFRASQFLAEELPIRLAHRV
QELDELPDGLNEMPSVRKVMTGTNLPPPFLQELTTLARPDLGKEVRERLMKPGKKFGRTS
AMLSETTRNPSIEDGQYSSISHSNGNGNGNGNGKKASAAARRYFAMVDDSGNWPAELRLY
NERFAKTLHNIKRRHDGVVTTMAQGILEYKRKRQRMQIDHNIQSFLDRFYMSRIGIRMLI
GQHIALTDQSHYRDPTYVGIICTKCNIQDLAQEAIENARFVCEDHYGLFEAPKIQLVCNP
NINFMYVPGHLSHMLFETLKNSLRAVVETHGQDKQEFPVTKVIVAEGKEDITIKITDEGG
GIPRSAIPLVWTYMYTTVDSTPNLDPDFDKNDFKAPMAGFGYGLPISRLYARYFGGDLKL
ISMEGLKDLEITERRQVGDAQDLLNRHSDASTSSGDFGYFRSDASEL
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtggaagaagaccgaggggttgatgaacaccatcaagcactatgccagctttcct
gctaccggcgtcagcttgcgccagatggttcaatttggcgagaagccctctaccggtacc
ctcttccgcgcctcgcagttcctagcggaggaacttcccattcgcctcgcccatcgtgtg
caagaactcgacgagcttcccgatggcctcaacgagatgccatccgtccgaaaggtcatg
actggaactaacttgcctcctcccttccttcaggagctcacaactctcgcgcgacccgat
ctcggcaaagaagtgcgagaacggctcatgaagcccggcaaaaagtttggcaggacatcc
gccatgctctccgagacaacgagaaaccccagcattgaagacggccagtacagctccatt
tcacactccaacggcaacggcaacgggaatggcaacgggaagaaggcgtccgccgccgcg
aggagatactttgccatggtcgacgactcgggcaactggcccgccgagcttcgcctgtac
aacgaaaggttcgccaagacgctgcacaacatcaagaggcgtcacgatggtgtcgtgacg
accatggcccagggtattctcgagtacaagcgcaagcgacagcgcatgcaaatcgaccac
aacattcagtctttcctagatcgcttctacatgtcccgaattggtatccgcatgctcatc
ggccagcatattgctctgacagaccagagccactatcgcgaccccacctacgtcggcatc
atctgcacgaaatgcaacatccaggatctcgcgcaggaagccatcgagaacgcccggttc
gtctgtgaggatcactatggcctcttcgaagcccctaagattcagctcgtttgcaacccc
aacatcaactttatgtatgtccccggacatctttcacacatgctcttcgagaccctcaag
aactcgctgcgtgccgttgtcgagacacacggccaggacaagcaggaattcccggtgaca
aaggtcattgtcgccgagggcaaggaggacatcaccatcaagatcaccgacgaaggcggc
ggcatccctcgcagcgccatccccctcgtctggacctacatgtacaccacggttgacagc
acgcccaaccttgacccggactttgataaaaacgacttcaaggcccccatggccggtttc
ggctacggcctgcccatatcgcgtctctacgctcgctactttggtggtgaccttaagctg
atcagcatggaggggctcaaggaccttgagatcaccgagcgccgccaggtcggcgacgcc
caggacctgctcaaccgccacagcgacgcctccaccagcagcggcgactttggatacttc
agaagcgacgcctcggagctgtaa

DBGET integrated database retrieval system