KEGG   Verticillium alfalfae: VDBG_08065
Entry
VDBG_08065        CDS       T02227                                 

Definition
(RefSeq) nitrite reductase
  KO
K17877  nitrite reductase (NAD(P)H) [EC:1.7.1.4]
Organism
val  Verticillium alfalfae
Pathway
val00910  Nitrogen metabolism
val01100  Metabolic pathways
Module
val_M00531  Assimilatory nitrate reduction, nitrate => ammonia
Brite
KEGG Orthology (KO) [BR:val00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    VDBG_08065
Enzymes [BR:val01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.4  nitrite reductase [NAD(P)H]
     VDBG_08065
SSDB
Motif
Pfam: Pyr_redox_2 NIR_SIR Pyr_redox Fer2_BFD NIR_SIR_ferr Rieske Rieske_2 Rubredoxin_C
Other DBs
NCBI-GeneID: 9529946
NCBI-ProteinID: XP_003001806
UniProt: C9ST40
AA seq 951 aa
MAERKKIVVVGLGMERDRRRVVGGGLLGLEAANAMMDLKCYDKVKLIERNRWVLSRQLDA
DAGTMVVEQVRDLGLDVLLSKRVGKVEVDADNYVTGVLFEDGEQMACSTICFAIGIRPRD
ALARKAGLKCADRGGGIIVGDDLSTSEPDIYAIGECASWQTQTFGLIAPGVEMADVLSFN
LTQAYLHSPRVFKTPDLSTKLKLLGVEVASFGDFFADRDGPKKLPPRAKRANKENAQTAL
ETLTNGLPPAPVKALTYRDPFSNVYKKYLFTEDGRYLLGGMMIGDTRDYIKLVPMVKNMK
VLDIPPSELILGAKKDGEDDGDDLSHDTQICSCHNVTKGDVVDAVKDGSCTSIGDIKACT
KAGTGCGGCMPLVTTIFNKTMASMGNEVKNHLCSHFKYSRAELYHIIMVKKLRTLAEVMR
EVGTEPDSLGCEACKPTIGGIFSSLWNRHVMDKPQHGLQETNDRFLGNIQRNGTYSVVPR
MSGGEVTPAKLIVIGQVAAKYKLYTKITGGQRVDMFGARRQDLPAIWRELIAGGMESGHA
YAKSLRTVKSCVGSTWCRYGIGDSVGLAVRLEERYKSIRAPHKIKGGVSGCVRECAEAQS
KDFGLIATDKGFNIYVAGNGGVTPRHAELLAKDVPPTEVIPILDRYLMFYIRTGDKLQRT
ASWIQALPGGLKYLQEVVLEDKLGICASLEAQMQELVDSFFDEWAEALATPSIINKFKQF
ANTDESVENVEIEAERDQERPVYWAPEAAKEDFKALKSRWTSKEWEPLLAASYFAGADDA
PNGISATIKRGDTQLAVWRVRGKASSARLQAKTRARTRPRRNSGCSTNGDAKKSAPWVSC
PYHKRNFDLANGDCKNDGELSIATFEAEERADGMVHVLLPPVAELDAELGTAKWKVKKGE
SGQAPFAGLDKAVGFKGIRGKKPGVKPFAPLKMNRPVEVLAGGGCGSAPDW
NT seq 2856 nt   +upstreamnt  +downstreamnt
atggcggagcgaaagaagattgtcgttgtcggcctgggcatggaaagggaccgtcggcgc
gttgtcggcggcggcctgcttggtctggaggctgccaatgccatgatggatctcaagtgc
tacgacaaggttaagctcatcgagaggaaccgatgggtactcagccgtcagctcgatgcc
gatgctggtaccatggttgttgaacaggtccgcgatctcgggctcgacgttctcctcagc
aagcgcgttggtaaggtcgaggtggatgccgacaactatgtgacgggcgttctgtttgag
gacggtgagcagatggcctgctcgacaatttgctttgccattggcattcgaccaagagat
gctctcgcccgcaaggccggcctcaagtgcgccgatcgcggcggtggtatcatcgtcggc
gatgatctgagcaccagcgagcccgacatttacgccattggcgagtgtgccagctggcag
acccagacctttggtctcatcgctcctggtgttgagatggccgatgtcttgtctttcaat
ctgacacaggcttacctgcactcgcctcgcgtcttcaagactccggatctgagcacgaag
ctcaagctgcttggagtggaagtcgccagctttggtgacttctttgctgatcgcgacggg
cccaagaagctgccgcctcgtgcgaagcgtgccaataaggagaacgcgcaaacggctctc
gagacgctcaccaacggcctgccgccagcaccggtcaaggcccttacctaccgcgacccc
ttctccaacgtgtacaagaaatatctgttcacggaagatggcaggtacctcctgggtggc
atgatgattggcgacacacgcgattacatcaagcttgtacccatggttaagaacatgaag
gttctcgacatcccaccgagcgagctgattcttggcgcgaaaaaagatggggaggacgat
ggtgacgatctatcccacgacacccaaatttgctcgtgtcacaacgtgaccaagggcgac
gtcgtcgacgccgtcaaggacggctcatgcacgagcatcggtgacatcaaggcgtgcacc
aaggccggcacgggctgtggcggctgcatgcccctcgtgacgactatcttcaacaagaca
atggcgtcaatgggcaacgaagtcaagaaccacctgtgttctcacttcaaatactcacgt
gccgagctctaccacatcatcatggtcaagaagctgcgtacgctcgccgaggtcatgcgc
gaagtcggaaccgagcccgactcgcttggctgcgaggcctgcaagcccacaattggcggc
atcttctcctcgctctggaatcgccacgtcatggacaagcctcagcacggtcttcaagag
accaacgaccgttttcttggaaacattcagcgcaacggcacttactcggttgtgcctcgt
atgtccggtggtgaagttactcccgcgaagctcattgtcatcggccaggtcgctgccaag
tacaagctttacaccaagatcactggtggccagcgcgttgacatgtttggtgcccgtcga
caggacctgcctgccatctggcgggagctcatcgctggaggcatggagtcgggccacgcg
tacgcgaaatcgctgcgtactgtcaagtcctgtgtcggaagcacgtggtgccgttacggt
atcggcgattcggttggcctcgctgtccgtctcgaggagcgctacaagtccatccgggcg
ccgcacaagatcaagggcggcgtcagcggttgcgtgcgtgagtgcgctgaagcgcagagc
aaggactttggcctcatcgcgacggacaagggcttcaacatctacgttgccggcaacggt
ggtgttacgccgaggcacgcagagctactggccaaggacgtaccgcccaccgaagtcatc
cctatccttgatcgctacctcatgttctacatccgcactggagacaagcttcagcggacg
gcgagctggattcaagcgctgccgggtggcctgaagtatctccaggaggtcgtgctcgaa
gacaagctcggcatctgtgcgtccctggaggcacagatgcaggaactcgttgacagcttc
tttgacgaatgggctgaggcacttgcgacgccttcgataatcaacaaattcaagcagttc
gccaatacggacgagtcggttgagaatgtggagatcgaggcggagcgtgaccaggagagg
cccgtgtactgggcgccagaggcggccaaggaggacttcaaggcgcttaagtcacggtgg
acatcgaaagagtgggagccccttcttgctgcctcctactttgccggcgccgacgatgcg
ccgaacggcatctcggcgacgatcaagcgcggtgacacgcagctcgccgtgtggcgtgtt
cgcggaaaggcctcatcggcgaggctacaggcgaaaacacgtgctcggacgcgcccaagg
cggaactccgggtgcagcaccaacggcgacgccaagaagtcggcgccgtgggtgtcgtgc
ccctaccacaagcgcaactttgacctcgccaacggcgactgcaagaacgatggcgagctg
agcatcgcgacattcgaggccgaggagcgcgccgacggcatggtgcacgtgctgctgccg
ccggtggctgagctcgacgccgaactcggcacggccaagtggaaggtcaagaagggagag
tctggccaggcgccgttcgcgggcctcgacaaggccgttggtttcaagggcattcgcgga
aagaagcccggcgtcaagccattcgcgccgctcaagatgaacaggccagtggaggtcctt
gccggaggcggatgcggaagcgcaccggattggtag

DBGET integrated database retrieval system