KEGG   Verticillium alfalfae: VDBG_08914Help
Entry
VDBG_08914        CDS       T02227                                 

Definition
(RefSeq) nucleoside transporter family
  KO
K15014  solute carrier family 29 (equilibrative nucleoside transporter), member 1/2/3
Organism
val  Verticillium alfalfae
Brite
KEGG Orthology (KO) [BR:val00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:val02000]
    VDBG_08914
Transporters [BR:val02000]
 Solute Carrier Family (SLC)
  SLC29: Facilitative nucleoside transporter
   VDBG_08914
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Nucleoside_tran
Motif
Other DBs
NCBI-GeneID: 9534511
NCBI-ProteinID: XP_003001118
UniProt: C9SVI9
AA seq 369 aa AA seqDB search
MDRIRDLFRQKDVREEYSPIVEDDNPMEGTALLEDDGEGVPFSWFEYSIFALLGMAMLWA
WNMFLAAAPYFQLRFQSDVWITQNFQSAILTVSTITNLGAMLVLTNMQAAASYPFRINLA
LTINVVIFMLLTASTSIFLDASPALYLTFLLTMVAATALAARPHPERRLRLRRLLHISTV
GGHPRKTVSPLTLLGKLHWLSAAVALCFAVSMFFPVFTGKILSVRTTDDGAAGSGSGSLF
RPAAFIPLAFFVWNAGDLAGRMATALPFSLRSRPPLLLALAVARLVWLPLYLLCNVNGRG
AVVASDLFYLVVVQFPFGLTNGWLGASCMMAGSEWVDEGEREVAGGFMGLCLVTGLTVGS
ILSFTVAGI
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atggatcgaatcagagacctcttccgacagaaggacgtccgcgaggagtacagtcccatc
gtcgaggatgacaacccgatggagggcacagccttgctggaagacgacggcgaaggcgtg
cccttctcgtggttcgagtacagcatctttgcgctgttgggcatggcgatgctctgggcc
tggaacatgttccttgccgcggcaccgtacttccagctgcgctttcaatccgatgtctgg
atcacgcagaacttccagtcggctatcctgactgtctcgacgatcacaaacctcggcgcc
atgctggtcctgacgaacatgcaggcggctgcctcgtacccgttccgcatcaacctcgcg
ctgacgatcaacgtcgtcatcttcatgctcctcacggcgtcaacgtctatcttcctcgac
gcgtccccggccttgtacctcacctttctcctgaccatggtcgccgccacggccctcgct
gctaggcctcatccagaacggcgccttcgccttcgccgcctccttcacatctccaccgtc
ggcggccatccccgcaagaccgtctccccgctgacgctcctcggcaagctgcactggctt
tcggccgccgtggccctctgcttcgccgtctccatgttcttccccgtctttacgggcaag
atcctctccgtgcgcaccaccgatgacggcgccgccggctccggctccggctccctcttc
cgccccgccgccttcatccccctcgccttcttcgtgtggaacgccggcgacctcgccggc
cgcatggccaccgccctgcccttcagcctgcggagccgtccgccgctgctgctggccctc
gccgtcgcgcgcctcgtctggctgccgctctacctgctctgcaacgtcaacggccgcggt
gccgtcgtcgcgagcgacctcttctacctcgtcgtcgtgcaattcccctttggcctcacc
aacggctggctcggcgcgagctgcatgatggccggcagcgagtgggtcgacgagggggag
agggaggtcgccggcggcttcatggggctgtgccttgtgacggggctgacggtgggcagc
atcttgagctttacggtcgcggggatttag

DBGET integrated database retrieval system