KEGG   Verticillium alfalfae: VDBG_09783Help
Entry
VDBG_09783        CDS       T02227                                 

Definition
(RefSeq) exoglucanase
  KO
K01225  cellulose 1,4-beta-cellobiosidase [EC:3.2.1.91]
Organism
val  Verticillium alfalfae
Pathway
val00500  Starch and sucrose metabolism
val01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:val00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    VDBG_09783
Enzymes [BR:val01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.91  cellulose 1,4-beta-cellobiosidase (non-reducing end)
     VDBG_09783
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_7 LPAM_2
Motif
Other DBs
NCBI-GeneID: 9531971
NCBI-ProteinID: XP_003000063
UniProt: C9SY08
AA seq 429 aa AA seqDB search
MFLLPLTLLGLPLALAQQIGTLVPEVPPALTWSNCTTESCTPVTDALTLDANWRWTHETT
SAHTCFLDGDWTDICYNLNSGTACAERCAIEGAEYASTHGITTAGGRASLRYVTHSAFGR
NVENRVFLLAPGGQYRMFELLGREVRVDVEVGTLGCGLKGALYFVKMEADGGRGRGKNAA
GARYGTGYCDAECSQSIKFVDGRANMEGWAPGYTDLELGRGAVGACCAEMGVWQSNSAST
AGAHAGSRTTFFPHGCDTDGCGASPYRLGNTHFYGQGKTLDSGAKFTVITRFHEDHVSQS
FIQAGEPIDTPTSQASGVQGNAISDDFCDSQASAFGERNRYAEVGGWSSTKRALAGQWVM
VMSITHDAYANMLWLDSLYPVDAAGRPGALRGPCPANRGYPAQTVAENPHCFNYAVAILV
TPGLTCRFW
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgttcctcctccccttgaccctcctcgggctccctctagccctcgcccaacaaataggc
acgcttgtccccgaagtcccccccgctctcacctggtccaactgcaccaccgaatcgtgc
acgcctgtcaccgacgcgctgaccctcgatgccaactggcgctggacacacgagacgacc
tcggcgcacacgtgcttcctcgacggcgactggacagatatctgctataacctcaacagc
ggcacagcgtgtgccgaacgctgcgccatcgagggcgccgagtacgcctcgacgcacggc
atcacgaccgcgggcggccgcgcgtcgctacggtacgtcacgcactctgcctttgggcgc
aacgtcgagaaccgcgtcttcctgctagcgccgggtggccagtatcgcatgttcgagctg
ctcgggcgcgaggtgcgcgttgacgtcgaggtcggcacgctagggtgtgggctcaagggg
gcgctgtactttgtcaagatggaggcagacggcgggcgcgggcgcggcaagaatgccgcc
ggcgcgcggtacggcacgggctactgcgacgcggagtgcagccagagcatcaagtttgtt
gatggccgggccaacatggagggatgggcgccggggtacacagatcttgagctcggacgc
ggcgccgttggggcctgctgtgccgagatgggcgtttggcagagcaattcggcgtcgaca
gccggtgcccacgcgggttctcggacgacattttttccgcatggctgcgataccgacggc
tgcggcgcgagcccgtaccgactgggcaacacgcacttttatgggcagggcaagacgctc
gacagcggggccaaatttaccgtcattacgcggtttcatgaggaccatgtctcgcaatcc
ttcatccaggccggcgagcccatcgacacgccgaccagccaggcgtccggcgtgcagggc
aatgccatctcagacgacttttgcgacagccaggcgtcggcgtttggggagcgcaaccgc
tacgccgaggtcggcgggtggtcgtcgacgaagcgggcgctcgcgggccagtgggtcatg
gtcatgtccatcacgcacgacgcctacgccaatatgctctggctcgactcgctgtacccg
gtcgacgccgccggtcggcccggtgcgctgagggggccgtgtccggcgaacagggggtat
ccggcgcagacggtggcggaaaacccgcactgcttcaactatgccgtcgctatcttggtc
accccggggttgacatgtcgcttctggtga

DBGET integrated database retrieval system