KEGG   Variovorax sp. PMC12: C4F17_09970Help
Entry
C4F17_09970       CDS       T05380                                 

Definition
(GenBank) haloacid dehalogenase type II
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
vam  Variovorax sp. PMC12
Pathway
vam00361  Chlorocyclohexane and chlorobenzene degradation
vam00625  Chloroalkane and chloroalkene degradation
vam01100  Metabolic pathways
vam01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:vam00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    C4F17_09970
   00361 Chlorocyclohexane and chlorobenzene degradation
    C4F17_09970
Enzymes [BR:vam01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     C4F17_09970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase HAD_2
Motif
Other DBs
NCBI-ProteinID: AVQ81246
UniProt: A0A2P1V7S9
Position
1:complement(2128322..2129050)
Genome map
AA seq 242 aa AA seqDB search
MRAGFDASDLKVIAFDVFGTVVDWHSGIAAEAESALPGVDGAAFALAWRAGYQPAMKAVM
ERIAAGEGGFTLLDELHLSMLEQVLHDFSLADRLDTAAKRELSRAWHRLPAWPDAVAGLT
RLKKKFTICTLSNGNIGLLTEMAKRAGLPWDCVLSAEVFKAYKPDPRTYLGVAGVFDATP
GQVMLAAAHHDDLAAARTCGLKTAYIERPHEFGRARPKDVSPQPDNHLHARDINELADLL
GC
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgccgggttcgacgcgagcgacctcaaggtcatcgcgttcgacgtcttcggcacg
gtggtcgactggcacagcggcattgcggccgaggccgaaagcgcgctgccgggtgtcgat
ggcgccgcgttcgcgctggcgtggcgcgcgggctaccagcccgcgatgaaggccgtgatg
gagcgcatcgccgcgggcgagggcggcttcaccctgctcgacgagctgcacctgagcatg
ctcgaacaggtgctgcacgatttcagcctggccgaccgcctcgacaccgccgccaagcgc
gaactgagccgtgcgtggcaccggctgccggcctggccagacgcggtggccggactcacg
cgcctgaagaagaaattcaccatctgcaccctgtcgaacggcaacatcggcctgctcacc
gaaatggccaagcgcgccggcctgccctgggactgcgtgctgtcggccgaggtgttcaag
gcctacaagcccgacccgcgcacctacctgggcgtggcgggcgtgttcgacgccacgccc
ggccaggtgatgctggccgcggcgcaccacgacgacctggccgccgcgcgcacctgcggc
ctgaagacggcgtacatcgagcgcccgcatgagttcggccgcgccaggccgaaggacgtg
tcgccgcagccggacaaccatctgcatgcgcgcgacatcaacgagctggccgacctgctg
ggctgctga

DBGET integrated database retrieval system