KEGG   Variovorax sp. PMC12: C4F17_16235Help
Entry
C4F17_16235       CDS       T05380                                 

Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
vam  Variovorax sp. PMC12
Brite
KEGG Orthology (KO) [BR:vam00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    C4F17_16235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF11 CARDB
Motif
Other DBs
NCBI-ProteinID: AVQ82376
UniProt: A0A2P1VB29
Position
1:3511316..3511711
Genome map
AA seq 131 aa AA seqDB search
MSLSPFSVQVEPRFLADQSSAKDNIYTFSYTVTVTNTGSVAAQLIARHWLINDASGHAQE
VKGLGVIGQQPLLAPGESFRYTSGCRLQAPSGTMHGSFFVVTEEGERFDVPIPMFVLEAD
IGGAPVSRVLH
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgtcactcagccccttcagcgtacaggtcgaaccgcgcttcctggccgaccagtcgtcc
gccaaggacaacatctacaccttttcctatacggtgacggtcacgaacaccggttcggtg
gccgcccagctgatcgcgcgccactggctgatcaacgatgcctcgggccatgcgcaggag
gtcaagggcctcggcgtgatcggccagcagccgctgctggcgcccggcgaatctttccgt
tacaccagcggctgccgcctgcaggcgcccagcggcacgatgcacggcagctttttcgtg
gtgaccgaggaaggcgagcgcttcgacgttcccattcccatgttcgtgctggaagccgac
atcggcggcgcacccgtctcccgcgtattgcactag

DBGET integrated database retrieval system