KEGG   Variovorax sp. PMC12: C4F17_23075Help
Entry
C4F17_23075       CDS       T05380                                 

Gene name
hemL
Definition
(GenBank) glutamate-1-semialdehyde-2,1-aminomutase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
vam  Variovorax sp. PMC12
Pathway
vam00860  Porphyrin and chlorophyll metabolism
vam01100  Metabolic pathways
vam01110  Biosynthesis of secondary metabolites
vam01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:vam00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    C4F17_23075 (hemL)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:vam01007]
    C4F17_23075 (hemL)
Enzymes [BR:vam01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     C4F17_23075 (hemL)
Amino acid related enzymes [BR:vam01007]
 Aminotransferase (transaminase)
  Class III
   C4F17_23075 (hemL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AVQ83601
UniProt: A0A2P1VEK3
Position
1:complement(4945736..4947016)
Genome map
AA seq 426 aa AA seqDB search
MTDRNDTLFERARAVIPGGVNSPVRAFKAVGGTPRFIQRAQGAYFWDANDKRYIDYIGSW
GPMILGHGHPAVVEAVQKAVLEGFSYGAPTEREIELAEAILALVPSMEMVRLVSSGTEAA
MSALRLARGATGRKSIVKFEGCYHGHADALLVKAGSGLATFGNPTSAGVPPEVVQHTIVL
EYNNLQQLEEAFALHGKDIACLMIEAIAGNMNFVRATPEFARRCRELCTQHGALLVFDEV
MTGFRVGLHGAQGVLGIKPDLTVLGKVIGGGMPLAAFGGPRAIMEQLAPLGPVYQAGTLS
GNPVATACGLATLKEIAKPGFYEALGQKTRSLVDGLQAAAAAEGQPFNADSEGGMFGFFL
MKDLPQNYATVMTTDNAKFNALFHGLLDRGVYIAPALYEAGFVSAAHSDDDIAATIEAAR
QIFRTP
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaccgcaacgacacccttttcgaacgcgcccgcgccgtgatccccggcggcgtc
aactcgcccgtgcgcgccttcaaggccgtgggcggcacgccccgcttcatccagcgcgcg
caaggcgcctatttctgggacgccaacgacaagcgctacatcgactacatcggctcctgg
ggtccgatgatcctgggtcatggccacccggccgtggtcgaggcggtgcagaaggcggtg
ctcgaaggcttctcctacggcgcgccgaccgagcgcgagatcgaactggccgaggccatc
ctcgcgctggtgccgtcgatggaaatggtccgcctggtcagctcgggcaccgaggctgcc
atgagcgcgctgcgcctggcgcgcggcgccaccgggcgcaagagcatcgtcaagttcgag
ggctgctatcacggccacgccgatgcgctgctcgtgaaggccggctccggcctcgccacc
ttcggcaacccgacctcggcaggcgtgccgcccgaggtggtgcagcacaccatcgtgctg
gagtacaacaacctgcagcagctggaagaagccttcgcgctgcacggcaaggacattgcc
tgcctgatgatcgaggccattgccggcaacatgaacttcgtgcgcgcgacgcccgagttc
gccaggcgctgccgcgagctgtgcacgcagcacggcgcgctgctggtgttcgacgaagtg
atgacgggctttcgcgtgggcctgcatggcgcgcaaggcgtgctgggcatcaagcccgac
ctcacggtgctgggcaaggtcatcggcggcggcatgccgctcgcggccttcggcgggccg
cgcgcgatcatggaacagctcgcgccgctgggtccggtctaccaggccggcacgctgtcg
ggcaatccggtggccacggcctgcggcctcgccacgctgaaggaaatcgccaagcccggt
ttctacgaggcgctgggccagaagacgcgctcgctggtcgacggcctgcaggccgccgcg
gccgccgaaggccagcccttcaatgccgacagcgaaggcggcatgttcggcttcttcctc
atgaaagacctgccgcaaaactatgccaccgtgatgacaaccgacaacgcgaaattcaat
gcgttgtttcacggtttgctcgatcgcggcgtgtatattgcccccgcgctttacgaggca
ggcttcgtgagcgcagcccacagcgacgacgacatcgccgccaccatcgaagccgcaaga
caaatcttcagaaccccctag

DBGET integrated database retrieval system