KEGG   Variovorax sp. PMC12: C4F17_25970Help
Entry
C4F17_25970       CDS       T05380                                 

Definition
(GenBank) anion permease
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
vam  Variovorax sp. PMC12
Brite
KEGG Orthology (KO) [BR:vam00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    C4F17_25970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AVQ84121
UniProt: A0A2P1VG44
Position
1:complement(5532526..5534157)
Genome map
AA seq 543 aa AA seqDB search
MNTLAAPHAELPSAPASHRPKLDAKPGPLTLITFVGLLAAGLLFTAWSLVGDVAASGVPV
TTWVPYILLGVALLIALGFEFVNGFHDTANAVATVIYTHSLPPNFAVVWSGFFNFLGVLV
SSGAVAFGIIALLPVELILQVGSSAGFAMVFALLIAAIIWNLGTWWLGLPASSSHTLIGS
IIGVGVANALMHGRDGTSGVDWGQATKVGYSLLLSPMVGFGCAALLLLALRAFVKNRALY
EEPKGSEPPPWWIRGLLILTCTGVSFAHGSNDGQKGMGLIMLILVGTVPMAYALNRAMPA
NETIKFVAVTEMAQNALNRSVPTSLPALQPEAARETLSTYVRTREFNASVVPALAAAAGS
IGQQVKAHGSLAGVPADSVANVRNDMYLASEAIRHLEKSGAAKFDDETRLRVVTFREELD
TATRFIPLWVKVAVAIALGLGTMIGWKRIVVTVGEKIGKTHLSYAQGASAEVVAMITIGA
ADMYGLPVSTTHVLSSGVAGTMTASGSGLQLSTLRNLALAWVLTLPVAMLLSGSLYWLFT
RIF
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atgaacacgcttgcagccccgcatgccgagttgccgtccgcgcctgcttcgcaccggccg
aaactcgacgccaagcccggtccgctcacgctgatcaccttcgtgggcctgctggcagcc
ggcctgctgttcacggcctggagcctggtgggcgacgtcgccgcctccggcgtgccggtc
acgacatgggttccctacatcctgctgggcgtggcgctgctgattgcgctgggcttcgag
ttcgtcaacggcttccacgacacggccaacgccgtggcgaccgtcatctacacgcactcg
ctgccacccaacttcgcggtggtgtggtcgggcttcttcaacttcctgggcgtgctggtt
tccagcggcgccgtggccttcggcatcatcgcgctgctgccggtggagctgatcctccag
gtcggctcgagcgcgggcttcgcgatggtgttcgcgctgctgattgccgcgatcatctgg
aacctgggcacgtggtggctcgggctgccggcttcgtcttcgcacacgctgatcggctcg
atcatcggcgtgggcgtggccaatgcgctgatgcacggccgcgacggcaccagcggcgtc
gactgggggcaggccaccaaggtgggctattcgctgctgctgtcgccgatggtcggcttc
ggttgtgccgccctgctgctgctggcgctgcgcgccttcgtgaagaaccgcgcgctgtat
gaggagcccaagggcagcgagccgccgccgtggtggatccgcggcctgctcatcctgacc
tgcaccggggtgtcgttcgcgcacggctccaacgacgggcagaagggcatgggcctcatc
atgctgatcctggtgggcacggtgccgatggcctatgcgctgaaccgcgccatgcccgcc
aacgagaccatcaagttcgtggcggtgaccgagatggcgcagaacgcgctgaaccgcagc
gtgccgacctcgctgcccgcgctgcaacccgaggcagcgcgcgagacgctctccacctac
gtgcgcacgcgggagttcaatgcctcggtcgtgccggccctggccgccgctgccggcagc
atcggccagcaggtcaaggcgcacggttcgctggccggcgtgcctgccgattccgtggcc
aacgtgcgcaacgacatgtacctggcctccgaagccatccgccatctggagaaaagcggc
gccgcaaagttcgacgacgagaccaggctgcgcgtggtcaccttccgcgaagaactggac
accgccacgcgcttcatcccgctgtgggtcaaggtcgcggtggccattgcgctgggcctg
ggcacgatgatcggctggaagcgcatcgtcgtgaccgtgggcgagaagatcggcaagacg
cacctgagctacgcgcagggcgcctcggccgaagtggtggccatgatcaccatcggcgcg
gccgacatgtacggcctgccggtatcgaccacgcacgtgctgtcctcgggcgtggccggc
accatgacggccagcggctcgggcctgcagttgtcgacgctgcgcaacctcgcgctggcc
tgggtgctcacgctgccggtggcgatgctgctgtcgggttcgctctactggcttttcact
cgcatcttctga

DBGET integrated database retrieval system