KEGG   Vibrio anguillarum 775: VAA_01652Help
Entry
VAA_01652         CDS       T01536                                 

Definition
(GenBank) Glutathione synthetase
  KO
K01920  glutathione synthase [EC:6.3.2.3]
Organism
van  Vibrio anguillarum 775
Pathway
van00270  Cysteine and methionine metabolism
van00480  Glutathione metabolism
van01100  Metabolic pathways
Module
van_M00118  Glutathione biosynthesis, glutamate => glutathione
Brite
KEGG Orthology (KO) [BR:van00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    VAA_01652
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    VAA_01652
Enzymes [BR:van01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.3  glutathione synthase
     VAA_01652
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSH-S_ATP GSH-S_N RimK ATPgrasp_YheCD ATP-grasp_3 Cupredoxin_1 ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: AEH34240
UniProt: F7YQP7
Position
I:2877840..2878823
Genome map
AA seq 327 aa AA seqDB search
MAILANRRKTMIKLGIVMDPISSINIKKDSSFAMLLEAQRRGYEIHYMEMNDLHLDQGVA
FADTKVVTLKEDPNGWYEFLSEQTIPLADLDAVLMRKDPPFDTEYIYATYILERAEEAGT
LIVNKPQSLRDCNEKLFTAWFPELTPTTIVTRKAEKIKAFRAQHGDVILKPLDGMGGASI
FRVKEGDPNVSVIIETLTNHGQNYCMAQTFVPDISNGDKRILVVDGEPMPYCLARIPAQG
ETRGNLAAGGRGEARPLSETDKKIAQTIAPTLKEKGLIFVGLDVIGDKLTEINVTSPTCI
REIEAAFDISITGKLMDAIERRINKSC
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
ttggcgatcttggctaaccggagaaaaacaatgattaaacttggtatcgtcatggaccct
atctcgtccattaacatcaaaaaagattccagctttgccatgttgctagaagcgcagcgt
cgtggttatgaaatccactatatggagatgaatgatctacacttagatcaaggtgtcgct
tttgccgataccaaagtggtgacattaaaagaagatccgaacggttggtatgagttttta
tctgagcaaactattccactggctgatctcgatgcagtattgatgcgtaaagatccgccg
tttgacactgaatatatctacgcaacctacattctagaacgagcagaagaagcaggaaca
ttaatcgtcaataagccgcaaagcttacgtgactgcaatgagaaactgtttacggcatgg
ttccctgaactaacgccaaccaccatagtgacgcgtaaagcggaaaaaattaaagccttc
cgcgcgcaacatggtgatgtgattttaaaaccgttagacggtatgggcggggcatctatc
ttccgcgttaaagagggtgatccaaacgtatctgtcattatcgaaacattaactaaccac
ggccaaaactactgtatggcgcaaacttttgtacctgacatcagcaacggtgataaacgt
attttagtggtcgatggtgaaccaatgccttactgcctagcgcgaattccggcacaaggt
gaaacccgtggcaatttggcagctggtggccgtggtgaagcgcgtccgctaagcgaaacc
gataaaaaaattgctcaaactattgctccaacattgaaagaaaaaggcttaatctttgtc
ggacttgacgttattggcgacaagctcactgagatcaacgtgacgagccctacgtgtatt
cgtgaaatagaggccgcctttgatatctcaattaccggtaagttgatggacgcgattgag
cgtcgaatcaacaagtcatgctga

DBGET integrated database retrieval system