KEGG   Vibrio anguillarum 775: VAA_01794Help
Entry
VAA_01794         CDS       T01536                                 

Definition
(GenBank) Maleylacetoacetate isomerase
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
van  Vibrio anguillarum 775
Pathway
van00350  Tyrosine metabolism
van00643  Styrene degradation
van01100  Metabolic pathways
van01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:van00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    VAA_01794
  09111 Xenobiotics biodegradation and metabolism
   00643 Styrene degradation
    VAA_01794
Enzymes [BR:van01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     VAA_01794
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C_3 GST_C GST_C_2 GST_N_4
Motif
Other DBs
NCBI-ProteinID: AEH33196
UniProt: F7YJ61
Position
I:1736622..1737272
Genome map
AA seq 216 aa AA seqDB search
MSGLKLYGYWRSSAAYRVRIALHLKALDYQSIAVHLVKEGGVQHSAEFSALNPSELIPVL
EDNGHCITQSLTIIEYLDDQYPQVRLVPLSGKEKYQIKALAQDIAIDIHPLNNLRVLQYL
TRELAVDESQKGDWYRYWIATGFHALEKKLATVSGEYCVGDQLSLVDVCLVPQVYNAERF
NLDMAQFPIIKRIVAELRAHPAFIAAAPENQPDAES
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgagtggcctcaagttatatgggtattggcgctcttcagccgcttaccgagtacgcatc
gcacttcacctcaaggcgctcgattaccagtcgattgctgtccatttagttaaggagggc
ggagtgcaacattcagccgagtttagcgctctcaatccgagtgagttaattccggtactg
gaagataacggacattgcattactcagtcgttaaccatcatcgaatatttggatgaccag
tatccccaagtacgtttggttccgctatcaggtaaagagaaatatcagattaaagcactg
gcgcaagacattgctattgatattcatccactgaacaatctacgagttttacaatattta
acgcgtgaactggccgtggatgaaagtcaaaaaggagactggtatcggtattggatagcc
acggggtttcatgccttggaaaagaaattggcgacagtatcaggggagtactgtgttggt
gatcaactgagcttagtggatgtttgtttagtaccacaagtgtataacgcggagcgcttt
aatcttgatatggcgcagtttccgatcatcaaacgaatcgttgctgagcttcgtgctcat
cctgcgtttattgccgccgcaccagaaaaccagcccgatgctgagagttaa

DBGET integrated database retrieval system