KEGG   Vibrio anguillarum 775: VAA_02154Help
Entry
VAA_02154         CDS       T01536                                 

Definition
(GenBank) Thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
van  Vibrio anguillarum 775
Pathway
van00240  Pyrimidine metabolism
van01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:van00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    VAA_02154
Enzymes [BR:van01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     VAA_02154
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_22 DUF4528 AAA_30
Motif
Other DBs
NCBI-ProteinID: AEH33418
UniProt: F7YKS3
Position
I:complement(1973791..1974417)
Genome map
AA seq 208 aa AA seqDB search
MNLVLSPIDLVTGISLLAQMYFYYSAMNAGKSTTLLQSSFNYQERGMTPVIYTAAIDDRY
GVGKVSSRIGLESDAQLFTAETNLYDEINALHEQQKRHCILVDECQFLTKDQVYQLTEVV
DKIGIPVLCYGLRTDFLGELFEGSKYLLSWADKLVELKTICHCGRKANMVIRTDEHGVAI
AEGDQVSIGGNDKYVSVCRQHYKEALGK
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
gtgaaccttgttctctcgccaattgacttagtgacaggaatctctcttttggctcaaatg
tatttctattactctgcgatgaatgcaggtaaatcaaccactcttctacaatcttctttc
aactaccaagagcgtggtatgacgcccgtgatctataccgctgccatcgacgaccgctat
ggtgttggtaaagtaagttcaagaataggattggaatcagacgcccagctttttaccgct
gaaacgaatttgtatgatgagatcaacgcactgcacgagcaacaaaagcgtcactgcatt
ttggttgatgagtgccaattcttaaccaaagatcaagtctatcaattgactgaagtggtc
gataaaatcggcattccggtactgtgctatggcttgcgtaccgatttcttaggtgagcta
tttgaagggagtaaatatctactttcttgggccgataagctggtggaattgaaaacaatt
tgtcattgtggccgtaaagcgaacatggtcattcgcaccgatgaacatggagtggcgatt
gccgaaggtgatcaagtctctattggtggtaacgataaatacgtgtcggtatgccgtcag
cactataaagaagccttgggtaagtaa

DBGET integrated database retrieval system