KEGG   Vibrio anguillarum 775: VAA_02479Help
Entry
VAA_02479         CDS       T01536                                 

Definition
(GenBank) dTDP-4-dehydrorhamnose 3,5-epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
van  Vibrio anguillarum 775
Pathway
van00521  Streptomycin biosynthesis
van00523  Polyketide sugar unit biosynthesis
van01130  Biosynthesis of antibiotics
Module
van_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:van00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    VAA_02479
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    VAA_02479
Enzymes [BR:van01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     VAA_02479
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom
Motif
Other DBs
NCBI-ProteinID: AEH31993
UniProt: F7YJ24
Position
I:430528..431073
Genome map
AA seq 181 aa AA seqDB search
MKVIETDIPDVKIIEPTVFGDERGFFMETWNQQRFEELVTGKPTQFVQDNHSKSKKGILR
GLHYQTENTQGKLVRVVSGEVFDVAVDIRKDSPTFGKWVGVHLSAENKRQLWVPEGFAHG
FYVTSEEAEFVYKCTNYYNPEAEHTLLWNDESINIDWPNKTCPLLSEKDVHGKHLSDIIL
L
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtgatagagacagacattcctgatgtcaaaattattgagccgaccgtgtttggt
gatgagcgtggtttttttatggaaacctggaaccaacagcgctttgaagaactggtaaca
ggtaagccaacgcagtttgtgcaagataatcactcaaaatccaaaaaaggaattttacgt
ggcttgcactaccagacagaaaacacgcaaggtaaattggttagagtggtatctggcgaa
gtgtttgatgtggcagtagatattcgaaaagattcaccgacgtttggcaaatgggttggt
gtgcacctgtcagcagagaacaagcgtcagttatgggtacctgaaggatttgcgcatggt
ttttatgtaaccagtgaagaagcggaatttgtgtataaatgtacgaactattataaccca
gaggctgagcacactttgctttggaatgatgaatccataaatattgattggccaaataaa
acgtgcccattactttccgagaaagatgttcatggtaaacatctttctgatattattttg
ctttaa

DBGET integrated database retrieval system