KEGG   Vibrio anguillarum 775: VAA_02790Help
Entry
VAA_02790         CDS       T01536                                 

Definition
(GenBank) Mannitol-1-phosphate 5-dehydrogenase
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
van  Vibrio anguillarum 775
Pathway
van00051  Fructose and mannose metabolism
van01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:van00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    VAA_02790
Enzymes [BR:van01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     VAA_02790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh UPF0052 Sacchrp_dh_NADP DotD ApbA
Motif
Other DBs
NCBI-ProteinID: AEH34922
UniProt: F7YT32
Position
II:563845..565008
Genome map
AA seq 387 aa AA seqDB search
MVGKIMKNAVHFGAGNIGRGFIGKLLADADIEVTFADVNEPLVDQLSHRQEYKVKVVGSE
CKIDTVTHVTAVNSASNDVIDRIVKTDLVTTAVGPAVLDIIAKTIAKGITKRFETGNEQP
LNVIACENMVRGTTHLKGEVYKYLDPSLHAKTDELIGFVDSAVDRIVPPVEAANDDPLAV
TVESFSEWIVDEQQFKGEIPNIEGMEKTNNLMAFVERKLFTLNTGHCITAYLGCLSGHKT
IREAIEDPAIRQQVKQAMHESGEVLIRRYGFDRELHAAYIEKILSRFANPYLVDEVDRVG
RQPIRKLGPNDRLIKPLLGTIEYGVENKMLLKGIAAALKYTNDSDPQAVELQTSLNQYGV
CKTLAHYTGLDEQSEQVKQIEAIYKQL
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
ttggtaggtaagattatgaaaaatgcagtacattttggcgcgggtaacattggtcgtggt
tttattggtaaattattggccgatgcagacattgaagtgacttttgccgatgtcaatgaa
cctttggtcgatcaattgagtcatcgtcaagaatacaaagtaaaggtagtgggttctgag
tgcaaaattgatactgtcactcatgtcactgcggtgaattcagccagtaatgatgtgatt
gatcgcattgtaaaaacggatttagtcactacagctgtcggccctgcagtgcttgatatc
attgcgaaaacgatcgccaaaggcatcaccaaaagatttgaaacgggcaatgagcagcca
ctcaatgtgatcgcttgtgaaaacatggtgcgcggtacaacacacctgaaaggcgaagtg
tataaatatctagacccatcgctgcatgctaaaaccgatgagttaattggttttgtcgat
tccgcggtggatcgcattgtgccacctgtcgaagccgcgaacgatgacccgttggccgtg
acggttgaaagtttcagcgaatggattgttgatgaacagcaatttaaaggtgagatcccc
aacattgaagggatggaaaaaaccaataatctgatggcttttgttgagcgtaaacttttc
actctaaatactgggcactgcattaccgcctatttgggttgtttgagtggtcataagacg
attcgtgaagcaattgaagatcctgcaattcgtcagcaagtgaagcaagccatgcacgaa
agcggtgaagtactcattcgtcgttacggttttgaccgtgaattgcacgccgcttatatc
gaaaaaatattgagccgctttgccaacccatatttggtggatgaagtggatcgcgttggt
cgtcagccaatacgaaaattaggccccaatgatagattaatcaagccattactcggtaca
atcgagtacggtgttgaaaacaaaatgctattgaaagggattgcggcggcccttaagtat
accaacgacagcgatcctcaagcggtcgagcttcaaacatcattgaaccaatatggcgta
tgtaaaacactggcccattacacagggttagatgagcagagcgagcaggttaagcaaatt
gaagcgatctacaaacagctttaa

DBGET integrated database retrieval system