KEGG   Vibrio anguillarum 775: VAA_02835
Entry
VAA_02835         CDS       T01536                                 

Definition
(GenBank) Hypothetical protein
  KO
K11905  type VI secretion system protein
Organism
van  Vibrio anguillarum 775
Brite
KEGG Orthology (KO) [BR:van00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:van02044]
    VAA_02835
Secretion system [BR:van02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   VAA_02835
SSDB
Motif
Pfam: GPW_gp25
Other DBs
NCBI-ProteinID: AEH34966
UniProt: F7YT72
Position
II:612991..613428
AA seq 145 aa
MTYIAPEESAFGVGFFERLEAGTKPMSLTQGPNAWDVLQSIKRNVSNILNTRMGEAQSAP
TLGLVDFNDATLETLDLSLRIKLAIQSCLDVYEPRLRNIVIRSESDVFSPLMLRFHIVAE
INSDALHEKVQFNLLLDQNRKYRVY
NT seq 438 nt   +upstreamnt  +downstreamnt
atgacttatattgcacctgaagagagtgcatttggtgtcggcttctttgaacgtttagaa
gctggcaccaagcctatgtctttgacccaagggccaaatgcatgggatgtgctccaatca
atcaaacgcaatgtttccaatattttgaatactcgcatgggtgaggcacaaagtgctcca
acgttaggtttagtggattttaacgatgcaacgttagaaaccttagacttatcgctgcgg
attaagcttgcgatacaaagctgcttagatgtgtatgagccccgtttacgaaatattgtg
attcgatccgagtcggacgtgtttagccctttgatgctgcgcttccatattgtggccgaa
ataaacagtgatgcgttacatgagaaagtgcagttcaacctgctactggatcaaaaccga
aagtaccgagtgtattag

DBGET integrated database retrieval system