KEGG   Vibrio anguillarum 775: VAA_02848
Entry
VAA_02848         CDS       T01536                                 

Definition
(GenBank) hypothetical protein
  KO
K11911  type VI secretion system protein VasL
Organism
van  Vibrio anguillarum 775
Brite
KEGG Orthology (KO) [BR:van00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:van02044]
    VAA_02848
Secretion system [BR:van02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   VAA_02848
SSDB
Motif
Pfam: ImpA_N Cytochrom_B562 Cytochrom_C_2
Other DBs
NCBI-ProteinID: AEH34977
UniProt: F7YT83
Position
II:630155..631450
AA seq 431 aa
MSNIVFIDHARFHLIDDAAAVRHIDAYQKVRDEINRRNNPLSGGPDWAVVKVACETLAKG
PGIDLLLCGYYTVACLKMQGLAGYANGVELLCCCLSNLPKPDVKSAKMRKEVLDWVNARV
VRELKDLRPNHEALRDLYRCERFCERMHAILELQQPDYLVDFEGVGFAIFEHIDRLETQY
HSLLKRHTQTEQVELVRNQKRSRVTHVAAFISGVLGVVMVYGAVTYLPFFNSMSYATNLR
LPALHTPEQVNAFQQANSPAKLEQLSNEIVPLYREAIEQKMARSFESARVEAQQVLDALL
QLYPQTESVLEVDQAFADAKREALQQTERFMERFSETRTKMANIALLAQKGKLTELQRQT
KSLEEFAISLSPIYGRAAYVEELLKKGDVVQAEQEFMILKQRLNNLSWKMAELDKQFEHL
TVTHNQEAQAQ
NT seq 1296 nt   +upstreamnt  +downstreamnt
atgtccaatattgtatttatcgaccacgctcgttttcatttgatagatgatgctgccgct
gttcgtcacattgatgcctaccaaaaggtgagagatgagatcaatcgtcgtaacaaccca
ttatcaggtggtccagactgggctgtggtgaaagttgcttgtgaaacattagcaaaaggc
ccggggattgaccttttgctgtgcggttattacaccgtagcctgtttaaaaatgcagggc
ttagcgggatacgccaatggtgttgaactgctgtgctgctgcttaagtaatttgccaaaa
ccggacgtaaaatcggcgaaaatgcgcaaggaagtgctcgattgggttaatgctcgtgta
gtgcgggagttaaaagatctgcgtccgaatcatgaagcactgcgtgatttataccgttgt
gagcgcttttgtgagcgcatgcatgccattttagagctgcaacagcccgactatttggtt
gatttcgaaggagtaggttttgctatttttgaacatattgatcgtttagaaacacaatat
cattcgctgctaaagcgccatactcaaacggaacaggttgagctggtgcgtaatcaaaag
cgctcacgtgttacgcatgtggccgcttttatatccggtgttcttggtgttgtgatggtg
tatggggccgtcacttatttgccgtttttcaactcaatgtcttatgcaaccaacctaagg
ttacctgctttacatacgccagagcaggtcaatgcgtttcaacaggctaactcgccagcc
aagcttgaacagttgtcaaatgagattgtgccattgtaccgagaggcgattgagcaaaaa
atggcgcgctcttttgaatcggctcgtgttgaagcccagcaagtgttggatgcgttattg
caactttatccccaaaccgaatcggtgctggaggttgatcaagcgtttgccgatgctaag
cgtgaagctctgcaacaaactgagcgctttatggagcgttttagtgaaacgcgaaccaag
atggctaacatcgcgctgctcgcgcaaaaaggaaaattaaccgaactgcaaagacaaacc
aaatcgctggaggagttcgctattagtttgtctcctatttacgggagagctgcatatgtc
gaagagttgctcaaaaaaggtgatgttgtacaggctgaacaggagtttatgattctgaag
cagcggcttaataatttgagctggaaaatggccgagctcgacaagcagtttgagcatttg
actgtgacacataatcaggaagctcaggctcaataa

DBGET integrated database retrieval system