KEGG   Vibrio anguillarum 775: VAA_02849
Entry
VAA_02849         CDS       T01536                                 

Definition
(GenBank) VgrG protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
van  Vibrio anguillarum 775
Pathway
van03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:van00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    VAA_02849
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:van02044]
    VAA_02849
Secretion system [BR:van02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   VAA_02849
SSDB
Motif
Pfam: Phage_GPD Phage_base_V DUF2345 DUF2917 Phage_Mu_Gp45
Other DBs
NCBI-ProteinID: AEH34978
UniProt: F7YT84
Position
II:631582..633666
AA seq 694 aa
MLFCDKRVEGKKMARLSFRLTVEGLADDTLVVHEYQGVESLSDSTQAGLRCYGFRYEIKL
ASRQSGLTALELVDKTAQLEILRDDLVVQRVHGIVRQFSKGDIGHHHTFYSLTLVPALER
LSLRQNSRIFQLKTVPEILSIVLQEMGINDYAFSLKRECAQREFCVQYRETDIDFLHRLA
AEEGLVYHFIHEEGKHTLFFSDDSQSLTKRETPIPYNVLAGGVMESPYVSQLTQHSQTEV
SHSALQDYSFKKPSYSFAQQAQGREMDYQQATYEHFDAPGRFKDDISGKAFNQIRLEYLR
REARTATGKSNHPGLQAGTKFDLQEHLDDSANRDWVVVQVHHQGQQPQALEEEGGSGATT
YSNQFTLIPADVTWRATPQAKPQVDGPCMALVVGPDGEEIFCDEHGRVKLHFPWDRYSNG
DEHSSCWVRVSQGWAGSQYGMIAIPRIGHEVIVSFLNGDPDQPIVTGRTYHATNKAPYAL
PDNKTKTVLRSETHQGEGFNELSFEDQAAQEKIYLHAQKDLDALVLNDATAHIKHDQHLT
VDNDQFTHVKHNQHLTVEGESRESVKGSCILMVDGSLHVKSGQVWTNESGDEIHIKAGQK
VVIEAGSEITVTAGGSFVKVDPAGVHLSGAGVNLNSGGSAGSGSGFSGDLPLLPGELELQ
KSPAPPQTILYQALLQAEEARVPAVKVCPLAGDA
NT seq 2085 nt   +upstreamnt  +downstreamnt
gtgttattttgcgataaaagagtggaagggaaaaagatggcaaggttaagttttaggctc
accgtggagggtttggcagacgacacgttagtggtgcatgaataccaaggtgtggaatcg
ctgtctgatagcacgcaagcgggcctgcgctgctacggttttcgctatgagataaaactg
gccagtcgtcaatctggcttaacggcactggagctggtggacaaaaccgctcagcttgag
atactgcgtgatgaccttgtcgtgcagcgcgtgcacggcattgtgcgccagttcagtaaa
ggcgatattggccatcatcacaccttttactcactgaccttagtcccggcattagagcgg
ttatcactgcgccaaaacagccgcatcttccagctcaaaaccgttcccgaaatcctctcc
atcgtactgcaagaaatgggcattaacgactacgccttctcgctgaagcgcgagtgtgca
cagcgtgaattctgcgtgcagtaccgtgagacggatatcgacttcttgcaccgcttagcc
gccgaagaaggcttggtgtatcacttcattcatgaagaggggaaacacaccctctttttc
agtgacgacagccaaagcctgacgaagcgagaaacgcctatcccttacaacgtccttgcg
ggtggcgtgatggagagcccttatgtgtcgcaattaacgcaacacagccaaaccgaagtg
agccacagcgcgctgcaagattacagctttaaaaagccgagctactcgtttgcccagcaa
gcgcaagggcgcgaaatggattaccagcaagcgacctacgagcactttgatgcaccgggt
cgctttaaagacgacatcagcggcaaagcctttaatcaaattcgcttagagtacttacga
cgagaagcgcgtaccgcgaccggaaaaagtaaccatccgggcctgcaagcgggcacaaag
ttcgacttacaagagcatcttgacgacagcgcgaaccgcgattgggttgtcgtgcaagtg
catcatcaggggcagcagccacaagcattggaagaagagggcggcagtggcgcgaccacg
tacagcaaccaattcacgctcattcctgctgatgtcacgtggcgtgcgacaccgcaagcc
aaacctcaagtggatggcccttgcatggcattggtggtggggcctgatggcgaagaaatc
ttctgtgacgaacatggccgcgtcaaactgcatttcccgtgggacagatattccaacggc
gatgaacacagctcatgctgggtgcgcgtctcacaaggttgggctggcagccaatatggc
atgatagccattccgcgcattggtcatgaagtcatcgtctcgtttcttaacggcgaccca
gaccaaccgatagtgacaggccgtacctaccatgcgaccaataaagcgccgtacgcactg
ccggataacaaaaccaaaaccgtgctgcgcagtgaaacgcaccaaggagaagggtttaac
gagctgagttttgaagaccaagcagcgcaagagaaaatctacctacacgcgcaaaaagac
ttagacgccttggtgctcaatgacgccacggcgcacatcaagcacgaccagcacctcacg
gtggataacgaccaattcacgcacgttaaacataaccagcacctcacggtggagggcgaa
agccgcgaatcggttaagggtagctgtatattaatggtcgatggttccttgcacgtaaaa
tcagggcaagtttggactaatgaaagtggagatgaaatccacatcaaagctggacaaaaa
gtggtgattgaagcagggtcagaaattaccgtgacagccggtggcagttttgtcaaagtc
gatcctgctggtgtccatctttctggggcgggcgttaatttaaactcaggcggaagtgcg
ggcagtggcagtggttttagtggcgatttaccgttattacctggtgagcttgaactgcaa
aaatcccccgcgccacctcaaaccattctttaccaagcgctattgcaagctgaagaagca
cgagtgccagccgtaaaagtatgcccattagccggggatgcctaa

DBGET integrated database retrieval system