KEGG   Vibrio anguillarum 775: VAA_03026
Entry
VAA_03026         CDS       T01536                                 

Definition
(GenBank) hypothetical protein
  KO
K11894  type VI secretion system protein ImpI
Organism
van  Vibrio anguillarum 775
Brite
KEGG Orthology (KO) [BR:van00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:van02044]
    VAA_03026
Secretion system [BR:van02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   VAA_03026
SSDB
Motif
Pfam: FHA Yop-YscD_cpl ThiS
Other DBs
NCBI-ProteinID: AEH33029
UniProt: F7YHZ6
Position
I:1544670..1545641
AA seq 323 aa
MNLLKVSQMPLSIRIISSPDGESIAQWNQAFPDDGGDIGRAFGATLQLNDASREISSTHA
MIRKTSRGYQIMDNSTNGLYINGSDVPLGKGNQSTLSDGDVLDIGRYRLLVSCFFPETAK
AQIQQPHSDSCRLGDDPFSTESTPFIQSIPEVDEAPGFTISTTDVVGDDPFASDASVKQE
LAPHFNLDFQTAEDDPLKDSDFRTSFPNHEVMATSSFAQEESPLNHSQFAITEFKNHGQR
LQERTDKALEMALARLLSDISPNAMESMFDDLSGNGFWSRKPKYWDMYKRYFNRQVENRD
WQIKFQAYFRDAMRMQKNFEGDQ
NT seq 972 nt   +upstreamnt  +downstreamnt
ttgaatttattgaaggtcagtcaaatgcctctatcgattagaattattagctctccagat
ggtgaaagcatcgcccaatggaatcaagcatttccagacgatggcggagatatcgggcgt
gcgtttggcgcgacgctacaacttaatgacgcaagtcgtgagatttcaagtacccatgca
atgattcgtaagacctcgcgtggataccaaatcatggacaacagcaccaatggcctttac
atcaatggatctgatgtgcctttgggcaagggtaaccaatctacactaagtgatggtgat
gttcttgatattggccgctaccgattgctggtttcttgtttcttccctgaaacagcgaaa
gcgcaaatccagcagcctcactcagatagttgtcgattaggtgatgatccgtttagtact
gaatcaacaccttttattcaaagtattcctgaagtagatgaagcgcctgggttcaccatc
tcgacgacagatgtggtgggggatgacccatttgcgagtgatgcctcagttaagcaagaa
ctagcgcctcactttaatcttgattttcagacggctgaggatgacccactgaaagacagt
gattttcgtacgtcatttccaaaccatgaagtgatggcgacctcctctttcgctcaagaa
gagtcaccactgaaccactctcagtttgctatcactgagtttaagaatcatgggcagcgc
ttacaggaacgtacggacaaagcattagagatggcattggcaaggttgttgtctgacatt
tcaccgaatgcgatggagtcgatgtttgatgatttgtcgggcaacggtttttggtctcgt
aaaccgaagtactgggatatgtacaaacgctatttcaaccgacaagtagagaatcgcgat
tggcaaattaagtttcaagcgtacttcagagatgcaatgcgtatgcaaaaaaacttcgaa
ggggatcagtaa

DBGET integrated database retrieval system