KEGG   Vibrio anguillarum 775: VAA_03032
Entry
VAA_03032         CDS       T01536                                 

Definition
(GenBank) hypothetical protein
  KO
K11895  type VI secretion system protein ImpH
Organism
van  Vibrio anguillarum 775
Brite
KEGG Orthology (KO) [BR:van00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:van02044]
    VAA_03032
Secretion system [BR:van02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   VAA_03032
SSDB
Motif
Pfam: T6SS_TssG
Other DBs
NCBI-ProteinID: AEH33023
UniProt: F7YHZ0
Position
I:1535732..1536715
AA seq 327 aa
MQEFVVSRFAHGAFEGQLEKAWQIFKHQAHLKGQRPEVRFSAEILPAYYQAEVSMVTSER
EGEFTVKTSLAALSGNSGSMPRAMYGDALKARFELGDEAPLDFFDMFNNRYYRLYCETKQ
KHELTYQIEEEAFHWNRDRQSITEMLSSLAGQTGDKAPMPESHLVQYTGLLGLKLTCPLA
LKSMLEDYFESEFEVERSGLEYLPLTECSLTQIGQAGNNHQLGVGALVGMSTPMTGQKLS
IKICPQDYQHYLKIRSDKEMVLALDHMVRSYMGVNTKYALYMKVNSQYLPRVKLSGSHQK
ALRIGQSAWMSHQSDRQQFVEMPLTKS
NT seq 984 nt   +upstreamnt  +downstreamnt
gtgcaagagtttgttgtaagccgtttcgctcatggtgcgtttgaaggtcagctagaaaaa
gcgtggcagatcttcaagcatcaggctcatttaaaggggcagcgacctgaagtgaggttc
agtgcggaaattctcccagcttactatcaagcagaagtctctatggttacttctgagcga
gagggtgaatttacggtaaagacatcattggcggctttgtctggcaactctggttcgatg
ccaagagcgatgtatggcgatgcactaaaagcgcgttttgaacttggtgatgaagcacca
ctcgactttttcgacatgtttaataaccgttactaccgcttgtactgcgaaacaaagcaa
aagcatgagctgacgtatcagattgaggaagaggcgtttcattggaatcgtgaccgtcaa
tctatcactgaaatgctttccagtttggcgggacagactggagataaggcaccaatgccg
gaatctcacttggtgcaatacactggcttattagggttgaagttaacctgtccattggcg
cttaagtcgatgctagaagattactttgagtcggagtttgaggttgaacgcagtggccta
gagtatttgcctctcacggagtgttcgttaactcaaattggccaagccggaaacaatcat
caattgggagtgggcgcgttggtcgggatgtcgacgccaatgacggggcagaaactcagc
ataaaaatttgccctcaagactatcagcattacttaaaaatacgcagtgacaaagagatg
gttcttgcgctggaccatatggttagaagctatatgggagtgaataccaagtatgcactc
tatatgaaggtaaatagccagtatctgccgagagtgaagctatcaggcagtcaccaaaaa
gcgttacgaattggccaatccgcgtggatgagtcatcaatcagatcgtcaacagtttgtt
gaaatgccactgacgaaaagttag

DBGET integrated database retrieval system